KEGG   Lactobacillus sanfranciscensis: LSA_06940Help
Entry
LSA_06940         CDS       T01627                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    LSA_06940 (glpK)
Enzymes [BR:lsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     LSA_06940 (glpK)
Exosome [BR:lsn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   LSA_06940 (glpK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
669802..671304
Genome map
AA seq 500 aa AA seqDB search
MKNEQYIMAIDEGTTSVRAILFNHQGKEIDRSQKEIKQVFPHPGWVEQDPNEIWNKTESV
ISDVLFKTETQPYKVRSIGISNQRETTVIWNKRTGKPIYNAIVWQSKQTNDIAKQIKQHG
LADEIQQKTGLIIDSYFSATKIRWILDHVDGAQTLAETGDLLFGTIDTWLLWKLTAGKVH
ATDVTNASRTMLFNINKLEWDQDLLDVFNIPKKMLPKVEESSHVYGYTQNFTFMGVQIPI
SGIAGDQQASLFGQLALKPGMTKNTYGTGAFIMMNLGDKPKFSKLGLLTTIAYGISGKVY
YAFEGSIFIAGSAVQWLKDELKLIENISGTANMAKTANDEPVFVVPAFTGLGAPYWNESV
RGSILGITNHTGINEIVKATLESLAFQTKDVINTMTEETQVPLNSLVIDGGVSKNDFLME
FQADILNQAIERSATSESTALGAAFLAGLAVGFWKDVDEIDGIKQTGQTFEPQMSEIERK
RLYHNWQLAVRTTETFEEKK
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatgaacaatatataatggcaattgacgagggaacaacatccgttcgtgccata
ttattcaatcatcaaggaaaagaaattgatcgttcacaaaaagaaatcaaacaagttttt
ccacatccaggttgggtagaacaagatccaaatgaaatctggaataaaactgagtcagta
atttctgatgtcttatttaaaactgaaacacaaccttataaggttcgttcaattggaatt
agtaatcaaagagaaactactgttatttggaataaaagaactggaaaaccaatttataac
gccattgtatggcagtcaaaacaaactaatgacattgcaaaacagattaaacaacatggt
ttagcagatgagattcaacaaaaaactggactaatcattgattcatacttttcagcaact
aaaattcgttggattttagatcatgttgatggggcacaaaccttagctgaaactggcgat
ttactttttggaaccattgatacatggttattatggaaattaaccgctggaaaagtacat
gctactgatgtaacgaatgccagtcgtaccatgttatttaatatcaacaaattagagtgg
gatcaggatttattagatgtttttaatatcccaaagaaaatgcttccgaaggttgaagaa
tcttctcatgtttatggatatacgcaaaattttaccttcatgggggtccaaattccgatt
tctggaattgctggtgatcaacaagcttctttatttggtcaattagcattaaaaccgggg
atgacgaaaaacacatatggaaccggtgcttttattatgatgaatttaggtgataaacct
aagttttcaaaactaggtttattaacgaccattgcttatggaattagtggcaaagtttat
tatgcattcgaaggtagtatctttatcgcaggatctgccgttcaatggttaaaagatgaa
ttgaaattgattgaaaatatcagtggaaccgctaatatggctaaaaccgcaaatgacgaa
ccagtatttgttgttcctgcttttacaggactaggtgcaccttattggaatgaaagtgtg
cggggatctattttaggaattaccaatcatactggaataaatgaaattgtaaaagccaca
ttagaatcattagcttttcaaactaaagatgtcatcaataccatgacagaagaaacacaa
gttccattaaattcattagtaattgatgggggagtttcaaaaaatgatttcttaatggaa
ttccaagcagatatcttaaatcaagcaattgaaagatcagcaacttctgaatcaaccgct
ttgggggctgcatttttagctgggttagcagttggattttggaaagacgttgatgaaatc
gatggaattaagcaaacaggacaaacatttgaaccacaaatgtctgaaattgaaagaaaa
cgactttaccataattggcagttagcagttagaactactgaaacattcgaggagaagaaa
taa

DBGET integrated database retrieval system