KEGG   Lactobacillus sanfranciscensis: LSA_09940Help
Entry
LSA_09940         CDS       T01627                                 

Definition
hypothetical protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:lsn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(966279..968744)
Genome map
AA seq 821 aa AA seqDB search
MPTSINIFDEPQLNNNQAEKPFVIGKVVTTFFEGADSFYKVLLVKVEKTNTDWTEEEIVV
TGNFADIAEETSYRFVGKLVDHPRYGKQFQADNYERASQSSPEGLIKYLASDDFPGIGKK
TAQKVVETLGTDLIEKIISDPTTIKKVGLNSKQNQTIVDGLRNNNGAEQVIVGLNGYGFG
SALAAAILKKYHEKALKVIQENPYQLVEDIKNISFKRADQIASKVGIEYNSAGRLRAGLL
TTLTRLSIRNGNTYSNSKELINASFEILDTDPQQQIDNQKLAQELKELVKDHKIEVDDGK
IYLKYLYDDEWKIAENAKRIIDDKQSSTKDYKTTIHEVENEAKIKYDDSQIAAINAALEN
QIFILTGGPGTGKTTIINGIVKSFAKVNKLSLDVNKYKDDAFPVLLAAPTGRAAKKMSES
TGIPAATIHRLLGLNGNDEEDGNDIDGQLLIIDEMSMVDTELFTKLMKSIPTGMKVILVG
DKDQLPSVGPGQVFYDLIRSEVIPKIELNQIHRQGDGSTIIQLAHEIKNGEIPQTLLDKE
KDRSFIQCNTSQVVKVIDQVVAKAKERKFTATDIQVLAPMYRGEAGIDRLNNDVQAIMNP
PKGEQQKQVEYQNVKYRIGDKVLQLVNAPEDNVFNGDIGKVVGIEINKDQKKYLDKLVVA
FDQTEVSYTRNDWNQLTLAYCTSIHKAQGSEFNMVILPIVPQYRRMLERNLLYTAVTRAS
QKLIMVGDVNSFAECISHVSSNRKTSLRERLDKIFNPKPVSEKPELVDKKVSTDIESEEP
KKDAEPDKYILTEAKILSNQIDPMVGMDGVKPNDFMDEKLE
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
ttgccaacatcaataaacatctttgacgaaccacaattgaataataatcaagcggaaaaa
ccatttgtgattgggaaggtagttactaccttttttgagggtgcagatagtttttataaa
gttttattggtgaaggttgaaaaaactaacactgattggactgaagaggaaattgtggtg
acaggtaattttgcagatattgccgaagaaactagctatcgatttgtgggaaaattggtt
gaccaccctcgttacgggaaacaatttcaagcggacaactatgaacgggcgagtcaaagc
tcacctgagggattgataaagtacttagcgagtgatgattttccgggaattggtaaaaaa
accgcccaaaaagtggttgaaactcttggaacagatttaattgaaaaaataatttcagat
cctacaacgattaaaaaagtcggattaaattccaaacaaaaccaaacgattgttgatggt
ttacggaataataacggtgctgagcaagtgattgttgggttaaatggatacggatttgga
agtgctttagcagctgcaattttaaaaaaataccatgaaaaagccttgaaagtaatccaa
gaaaatccttatcaattggttgaagatatcaaaaatattagttttaaacgagctgatcaa
attgccagtaaagtaggaattgaatataattcagcgggaagattgcgagctggattatta
acgactttaactcggctctcaattagaaacggaaatacttactctaattcaaaggaattg
attaatgctagttttgaaatcctggatactgatccacaacaacagatcgataatcaaaag
ttagctcaagaactaaaagagttagttaaagaccataaaatcgaagttgacgatggaaaa
atttatcttaaatatttatatgatgatgagtggaaaattgcagaaaatgcaaaacggatt
attgatgataagcaaagttctacaaaagattacaaaaccaccattcacgaagttgaaaat
gaagctaaaatcaaatatgatgattctcaaattgccgcaattaacgctgcgctagagaat
caaatttttattttaactggtggaccgggaactggaaaaacgaccatcattaatggaatt
gttaaatcctttgcaaaagttaacaaattatctttagacgttaataaatacaaagatgat
gcatttccggttctattagctgctccaactgggcgagctgccaaaaaaatgagtgaatca
actggtattccggctgctacaattcatcgtttattgggcttgaatggaaatgatgaagaa
gacgggaatgatattgacgggcaattattgattattgatgaaatgtcgatggtcgatacc
gaattatttactaaattaatgaaatcaattccgactggaatgaaggttattttagtcgga
gataaagatcaacttccatcagtgggaccggggcaggttttttatgatttaattcgttcg
gaagtaattcccaaaattgaattaaatcaaattcatcgtcaaggtgatggatcaacaatt
attcaattggctcatgaaattaaaaatggggaaattccccaaactttattagataaagaa
aaagatcgtagttttattcagtgtaatactagccaagttgtaaaagtaattgaccaagtg
gttgccaaagccaaagaaagaaagtttacagcaactgatattcaagtcttagctccgatg
tatcgtggtgaagcaggaattgatcgtttaaataatgacgttcaagcaattatgaaccca
ccaaaaggtgagcagcaaaagcaagttgaatatcaaaacgttaaatatcgaattggggac
aaagtcttacaacttgttaatgcacccgaagataacgtttttaacggcgacattggtaag
gtagttggaattgaaataaataaagatcagaaaaagtatcttgataaattggtagttgcc
tttgaccaaactgaagtttcttacacgagaaatgattggaaccaattgactttagcatac
tgcacttccatccacaaagctcaaggaagtgagttcaatatggtaattttaccgattgtt
cctcaatatcggcggatgctggaaagaaatttgttgtataccgctgttactagagcttct
caaaagttaattatggtcggggatgttaattcctttgctgaatgtatttcacatgtttct
agtaatcgaaagacatctttaagagaacgcttagataaaatttttaatccaaaaccagtt
tcagaaaaaccagaattagtggataaaaaagtttcaactgatattgaatcagaggagccc
aaaaaggatgctgaaccagataagtatattttaactgaagccaaaattctttctaatcaa
attgatccaatggttggaatggatggagtgaaacctaacgattttatggatgaaaagttg
gagtaa

DBGET integrated database retrieval system