KEGG   Lactobacillus sanfranciscensis: LSA_10700Help
Entry
LSA_10700         CDS       T01627                                 

Definition
hypothetical protein
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    LSA_10700
  Amino acid metabolism
   00300 Lysine biosynthesis
    LSA_10700
Enzymes [BR:lsn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     LSA_10700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1044962..1046185)
Genome map
AA seq 407 aa AA seqDB search
MNKEEKLAILEKLVSFNTSEGNELAEAQYLQDLLLEHGIESEIENLGNHEANLIAEIGNG
QKPVFTISGHLDTVAVDVDKWDTDPFTLVRKDGQMYGSGVTDMKGGTAALVIAMITLKDA
EFPLNGTLRLVLTAGEESNMHGSHQLYADGAMNDSDTLLIAEPTGYRTVYANKGEVDFKI
TAQGKAAHSSRPNFGINAIQNLMDVLELIKTKVEARAEQNQDDVLGKTTFTVDIFKGGIQ
INAIPANAKAEINTRIVPEYSNDEVMADVKAVVDEFNQTHAGEIEIEILMNIPPVIGNPE
SKLIKDIIKIATSYMKNTEYTPSEKQQGKEMQAKQGFNPFSNDKFDVLSGAGGTDASELL
KDKLMGTNYAVFGPGNPLKMHQTNEYASEQMWFDFIDIYEKLFKEYL
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgaataaagaagaaaaattagcgatattagaaaaattagttagttttaacacctcagaa
ggtaacgaacttgccgaggctcaatatttacaagacttgttgttagaacacggaatcgaa
agtgaaattgaaaatttaggcaatcatgaagctaatttaattgcagaaattggaaacgga
caaaaaccggttttcacgattagtggacatttagatacagtggcggtcgatgtcgataaa
tgggatactgatccatttactttagttcgtaaagacggccaaatgtatggaagtggtgtg
actgacatgaaaggtggcactgctgcattagtgattgccatgattactctaaaagatgct
gagtttccattgaatggaacgttacgtttagttttaacggccggcgaagaatcaaatatg
cacggttctcaccaattatatgctgacggagccatgaatgattcagacacgcttttaatt
gctgaaccaactggctaccggacagtttacgccaacaagggtgaagtcgactttaagatt
accgcacaaggaaaagccgcacatagttcacggcctaactttgggattaatgcgattcaa
aatttaatggatgttttagaattaatcaaaacgaaagttgaagctcgagctgaacaaaat
caagatgatgttttagggaaaacaacctttacagtcgatatcttcaaaggtggaattcaa
attaatgcaattcccgcaaatgctaaagctgaaattaacacgcggattgtgcctgaatat
tctaatgatgaagttatggcagatgtgaaagccgttgttgatgagtttaaccaaactcat
gctggtgaaattgaaattgaaattttaatgaacattcctccagttatcggaaatccagaa
tcaaaattaattaaagacattattaaaattgctacttcttacatgaaaaacaccgaatac
actccttcagaaaaacaacaggggaaagaaatgcaagctaagcagggattcaatcctttt
tcaaatgataagtttgatgtattgagtggtgctggcggaacggatgcttctgagttactt
aaagataaattaatgggaactaactacgccgtctttggtccaggtaacccattgaaaatg
caccaaaccaatgaatatgcttcagaacaaatgtggtttgattttattgatatttatgaa
aaattgtttaaagaatatttgtga

DBGET integrated database retrieval system