KEGG   Lactobacillus sanfranciscensis: LSA_12190Help
Entry
LSA_12190         CDS       T01627                                 

Gene name
adhA
Definition
(GenBank) Alcohol dehydrogenase 1
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00010  Glycolysis / Gluconeogenesis
lsn00071  Fatty acid degradation
lsn00625  Chloroalkane and chloroalkene degradation
lsn00626  Naphthalene degradation
lsn01100  Metabolic pathways
lsn01110  Biosynthesis of secondary metabolites
lsn01120  Microbial metabolism in diverse environments
lsn01130  Biosynthesis of antibiotics
lsn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_12190 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA_12190 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA_12190 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA_12190 (adhA)
   00626 Naphthalene degradation
    LSA_12190 (adhA)
Enzymes [BR:lsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA_12190 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 MTS NAD_binding_2 TrkA_N Methyltransf_25
Motif
Other DBs
NCBI-ProteinID: AEN99593
UniProt: G2KUJ5
Position
complement(1166858..1167958)
Genome map
AA seq 366 aa AA seqDB search
MISRYNELVRKTINSFIKKRRFIMVKAAVVRPNSDGYVDIKDVTLRPIRSNEALVKVEYC
GLCHTDLHVASGDFGEVPGRIIGHEGVGRVTQIGENVTNLKIGDRVSIAWFYSADGTCKY
CVTGNETLCRNVKNAGYTVDGAMAEECIVDAKYAVKVPEGLDPVEATSLTCAGVTTYGAL
KIGDTKPGEWTQIVGAGGLGNLGVQLAHNVFGAKVVVTDGDPKKLEAAKENGADLVVNRH
DADATEQVIKGTNGGVHDSIVTAVSAQAFTNAVNALEPNGTLVAVALPKGDMALNIDKTV
LDGIKVAGSLVGTRQDLRETFDFGAQGKVKPIVRTEKLENINKVIDEMKAGKIVGRVVFD
FTGDKD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
attatttcacgttataatgaacttgttagaaagacaattaatagtttcataaaaaagagg
agatttattatggttaaagctgctgttgttagacctaattcagatggatatgttgatatt
aaagatgttactttacgtcccattcgttcaaatgaagcattagtaaaagttgaatattgt
ggactttgtcacaccgatttacacgttgcctcaggtgattttggtgaagtacctggtcga
attatcggacatgaaggtgttggtcgcgttacccaaattggtgaaaacgttactaactta
aagattggtgatcgagtatcaatcgcttggttctactcagctgatggtacttgtaagtac
tgtgtaactggtaatgaaactctttgtcgtaacgttaagaacgcaggttacactgttgat
ggtgccatggctgaagaatgtatcgttgatgccaaatacgctgttaaagttcctgaagga
cttgacccagttgaagctacctcattaacttgtgccggagttactacttacggagctctt
aaaattggtgatactaaacctggtgaatggactcaaatcgttggtgccggtggtttaggt
aacttaggtgttcaattagctcacaacgttttcggtgctaaagtagttgttactgatggt
gatcctaagaagcttgaagctgctaaagaaaatggtgctgacttagttgttaaccgtcat
gatgctgacgcaactgaacaagttataaaaggaactaatggtggggttcacgattcaatc
gtaaccgccgttagtgctcaagcatttactaatgccgttaacgccttagaaccaaatggt
actttagttgccgttgctcttcctaaaggtgatatggcacttaatattgataaaacagtt
cttgatggaattaaggttgctggatctcttgttggtactcgtcaagatttacgtgaaacc
tttgacttcggtgctcaaggaaaagttaaaccaatcgttagaactgagaaacttgaaaac
atcaacaaagttatcgacgaaatgaaagccggtaaaattgttggacgagttgtattcgac
ttcactggtgataaagactaa

DBGET integrated database retrieval system