KEGG   Lactobacillus sanfranciscensis: LSA_12190Help
Entry
LSA_12190         CDS       T01627                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA_12190 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_12190 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA_12190 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA_12190 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA_12190 (adhA)
   00626 Naphthalene degradation
    LSA_12190 (adhA)
Enzymes [BR:lsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA_12190 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1166858..1167958)
Genome map
AA seq 366 aa AA seqDB search
MISRYNELVRKTINSFIKKRRFIMVKAAVVRPNSDGYVDIKDVTLRPIRSNEALVKVEYC
GLCHTDLHVASGDFGEVPGRIIGHEGVGRVTQIGENVTNLKIGDRVSIAWFYSADGTCKY
CVTGNETLCRNVKNAGYTVDGAMAEECIVDAKYAVKVPEGLDPVEATSLTCAGVTTYGAL
KIGDTKPGEWTQIVGAGGLGNLGVQLAHNVFGAKVVVTDGDPKKLEAAKENGADLVVNRH
DADATEQVIKGTNGGVHDSIVTAVSAQAFTNAVNALEPNGTLVAVALPKGDMALNIDKTV
LDGIKVAGSLVGTRQDLRETFDFGAQGKVKPIVRTEKLENINKVIDEMKAGKIVGRVVFD
FTGDKD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
attatttcacgttataatgaacttgttagaaagacaattaatagtttcataaaaaagagg
agatttattatggttaaagctgctgttgttagacctaattcagatggatatgttgatatt
aaagatgttactttacgtcccattcgttcaaatgaagcattagtaaaagttgaatattgt
ggactttgtcacaccgatttacacgttgcctcaggtgattttggtgaagtacctggtcga
attatcggacatgaaggtgttggtcgcgttacccaaattggtgaaaacgttactaactta
aagattggtgatcgagtatcaatcgcttggttctactcagctgatggtacttgtaagtac
tgtgtaactggtaatgaaactctttgtcgtaacgttaagaacgcaggttacactgttgat
ggtgccatggctgaagaatgtatcgttgatgccaaatacgctgttaaagttcctgaagga
cttgacccagttgaagctacctcattaacttgtgccggagttactacttacggagctctt
aaaattggtgatactaaacctggtgaatggactcaaatcgttggtgccggtggtttaggt
aacttaggtgttcaattagctcacaacgttttcggtgctaaagtagttgttactgatggt
gatcctaagaagcttgaagctgctaaagaaaatggtgctgacttagttgttaaccgtcat
gatgctgacgcaactgaacaagttataaaaggaactaatggtggggttcacgattcaatc
gtaaccgccgttagtgctcaagcatttactaatgccgttaacgccttagaaccaaatggt
actttagttgccgttgctcttcctaaaggtgatatggcacttaatattgataaaacagtt
cttgatggaattaaggttgctggatctcttgttggtactcgtcaagatttacgtgaaacc
tttgacttcggtgctcaaggaaaagttaaaccaatcgttagaactgagaaacttgaaaac
atcaacaaagttatcgacgaaatgaaagccggtaaaattgttggacgagttgtattcgac
ttcactggtgataaagactaa

DBGET integrated database retrieval system