KEGG   Lactobacillus sanfranciscensis: LSA_12190Help
Entry
LSA_12190         CDS       T01627                                 

Gene name
adhA
Definition
(RefSeq) alcohol dehydrogenase (EC:1.1.1.1)
  KO
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    LSA_12190 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LSA_12190 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    LSA_12190 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    LSA_12190 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LSA_12190 (adhA)
   00626 Naphthalene degradation
    LSA_12190 (adhA)
Enzymes [BR:lsn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     LSA_12190 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1166858..1167958)
Genome map
AA seq 366 aa AA seqDB search
MISRYNELVRKTINSFIKKRRFIMVKAAVVRPNSDGYVDIKDVTLRPIRSNEALVKVEYC
GLCHTDLHVASGDFGEVPGRIIGHEGVGRVTQIGENVTNLKIGDRVSIAWFYSADGTCKY
CVTGNETLCRNVKNAGYTVDGAMAEECIVDAKYAVKVPEGLDPVEATSLTCAGVTTYGAL
KIGDTKPGEWTQIVGAGGLGNLGVQLAHNVFGAKVVVTDGDPKKLEAAKENGADLVVNRH
DADATEQVIKGTNGGVHDSIVTAVSAQAFTNAVNALEPNGTLVAVALPKGDMALNIDKTV
LDGIKVAGSLVGTRQDLRETFDFGAQGKVKPIVRTEKLENINKVIDEMKAGKIVGRVVFD
FTGDKD
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
attatttcacgttataatgaacttgttagaaagacaattaatagtttcataaaaaagagg
agatttattatggttaaagctgctgttgttagacctaattcagatggatatgttgatatt
aaagatgttactttacgtcccattcgttcaaatgaagcattagtaaaagttgaatattgt
ggactttgtcacaccgatttacacgttgcctcaggtgattttggtgaagtacctggtcga
attatcggacatgaaggtgttggtcgcgttacccaaattggtgaaaacgttactaactta
aagattggtgatcgagtatcaatcgcttggttctactcagctgatggtacttgtaagtac
tgtgtaactggtaatgaaactctttgtcgtaacgttaagaacgcaggttacactgttgat
ggtgccatggctgaagaatgtatcgttgatgccaaatacgctgttaaagttcctgaagga
cttgacccagttgaagctacctcattaacttgtgccggagttactacttacggagctctt
aaaattggtgatactaaacctggtgaatggactcaaatcgttggtgccggtggtttaggt
aacttaggtgttcaattagctcacaacgttttcggtgctaaagtagttgttactgatggt
gatcctaagaagcttgaagctgctaaagaaaatggtgctgacttagttgttaaccgtcat
gatgctgacgcaactgaacaagttataaaaggaactaatggtggggttcacgattcaatc
gtaaccgccgttagtgctcaagcatttactaatgccgttaacgccttagaaccaaatggt
actttagttgccgttgctcttcctaaaggtgatatggcacttaatattgataaaacagtt
cttgatggaattaaggttgctggatctcttgttggtactcgtcaagatttacgtgaaacc
tttgacttcggtgctcaaggaaaagttaaaccaatcgttagaactgagaaacttgaaaac
atcaacaaagttatcgacgaaatgaaagccggtaaaattgttggacgagttgtattcgac
ttcactggtgataaagactaa

DBGET integrated database retrieval system