KEGG   Lactobacillus sanfranciscensis: LSA_12760Help
Entry
LSA_12760         CDS       T01627                                 

Gene name
cap4C
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lsn  Lactobacillus sanfranciscensis
Pathway
lsn00040  Pentose and glucuronate interconversions
lsn00052  Galactose metabolism
lsn00500  Starch and sucrose metabolism
lsn00520  Amino sugar and nucleotide sugar metabolism
lsn01100  Metabolic pathways
lsn01130  Biosynthesis of antibiotics
Module
lsn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lsn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    LSA_12760 (cap4C)
   00052 Galactose metabolism
    LSA_12760 (cap4C)
   00500 Starch and sucrose metabolism
    LSA_12760 (cap4C)
   00520 Amino sugar and nucleotide sugar metabolism
    LSA_12760 (cap4C)
Enzymes [BR:lsn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     LSA_12760 (cap4C)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3
Motif
Other DBs
NCBI-ProteinID: AEN99641
UniProt: G2KUP3
Position
complement(1221435..1222313)
Genome map
AA seq 292 aa AA seqDB search
MKKVTKAIIPAAGLGTRFLPETKAVPKEMLPIVDTPTIQYIVEEAKASGITDLAIVTGSG
KGSIEDHFSSNYLLEQNLERKGKDEMLKAVQKTNDMNIYFIRQAYPKGLGDAVLTAKTFV
GNEPFVVMLGDDLMTDKVPLTKQLIDSYEKSGASTLAVMRVPHEETVKYGVIDPIEEVSD
GMYDVKQFVEKPAPEDAPSDLAIIGRYLFTPEIMDVLETTKPGKGNEVQLTDAIDTLNKT
QKVYAHEFKGDRFDTGNKLSWLETNIEFALRRQDLSDDLKAYIIDLANKLEK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagttacaaaggctattattcctgctgctggtttaggaactcgtttcttacca
gaaactaaggcagttcctaaagaaatgttaccaattgttgatacaccaacaattcaatac
attgttgaagaagctaaagcttctggtattacagatttggccattgtgactggttcagga
aaaggttcaattgaagatcacttttcatctaattatttgttagaacaaaaccttgaaaga
aaaggtaaagatgaaatgttgaaagctgttcaaaaaacgaatgatatgaacatttacttt
attcgtcaagcatatcctaaaggtttgggagatgcagtgttgactgctaaaacatttgtt
gggaacgagcctttcgttgtcatgcttggtgatgatttgatgactgataaagttccttta
actaaacaattgattgatagttacgaaaaatcaggtgcttcaacgcttgctgtaatgcga
gttccacacgaagaaaccgttaaatatggtgtgatcgatcccattgaagaagttagcgac
ggtatgtacgacgttaaacaattcgtggaaaagccagctccagaagatgcaccaagtgat
ttagctatcattggtcgttacttgtttactccagaaattatggatgttttggaaactacg
aaacctggtaaaggtaacgaagttcaattaactgatgccattgatactttgaacaaaacc
caaaaagtttatgctcatgaattcaagggtgatcgatttgacactggtaacaaacttagt
tggttagaaactaacattgagtttgcactacgtcgtcaagatttaagtgatgatttgaag
gcttatatcattgatttagctaacaaattggaaaaataa

DBGET integrated database retrieval system