KEGG   Candidatus Liberibacter solanacearum: CKC_01245Help
Entry
CKC_01245         CDS       T01373                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKC_01245
  Amino acid metabolism
   00300 Lysine biosynthesis
    CKC_01245
Enzymes [BR:lso01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CKC_01245
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
240827..241924
Genome map
AA seq 365 aa AA seqDB search
MLADTLKPLGFSIKQQIFQEENTPDVKNIYARFGVKKPHLMFAGHVDVVPPGNLDEWMYP
PFSATVAEGRIYGRGAVDMKGSIACFIAAVSRFIPKHTNFGSISLLITGDEEGPAINGTK
KMLSWAKKNGEQWDACIVGEPTCSHILGDTIKIGRRGSLSGEIIIHGTQGHVAYPHLANN
PIKGLIPLLHQLTTIEFDTGNTDFPSTNLEITTVDVGNPAKNIIPAKVKISFNIRFNNLW
NEQTLKKEIESRLTKSLQNMPKLSYNLHFSSPVSPVFLTDNKTLTSLLSESIHRVTGGTP
QLSTTGGTSDARFIKDHCPVIEFGLVGKTIHAVNENVLLKDLEDLTCIYEDFLHNWFISS
SLSIE
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctgatactttaaaacctcttggcttttccatcaaacaacaaatttttcaagaa
gaaaatacacccgacgttaagaatatttatgctcgttttggtgtaaaaaaaccccattta
atgtttgctggacacgttgatgtcgttcctcctgggaatcttgatgaatggatgtatcca
ccattttcagctaccgttgcagaaggaagaatatatggacgcggagctgttgatatgaag
ggaagcattgcttgttttatagccgccgtttctagatttattccaaaacatacaaatttc
ggatctatttcccttctaattaccggagacgaagaaggccctgcaataaatggaacaaaa
aagatgctttcatgggcaaaaaaaaacggagaacaatgggatgcatgcatagtaggagag
ccaacctgtagccatatcctcggagatacaataaaaataggacgcagaggcagtctctcc
ggtgaaatcataatccatggaacacaaggacatgtagcttatccacacctagcaaacaat
ccaataaaaggacttatcccattactgcatcaattaacaaccatagaatttgacaccggt
aatactgattttccttcaacaaatctagaaataacgacagtagacgtaggaaatcctgca
aaaaacattatcccagcaaaagtaaaaatctcttttaacatacgctttaacaatctatgg
aacgaacaaaccttaaaaaaagaaatagaatctcgactaacaaaaagcttacaaaatatg
ccaaaattatcttataacctacacttttcatcacctgtaagccctgtttttttaacagat
aacaagacactaacctctttgttaagcgaaagtatccatcgtgtaactgggggaacaccc
caattatctacaactggaggaacgtctgatgcccgctttatcaaagatcactgcccagtt
atagagtttggacttgtaggaaaaacaattcacgcagtgaatgaaaacgtacttctcaaa
gaccttgaagatttaacttgcatatatgaggattttcttcacaattggttcataagctca
tccctatcaatcgaataa

DBGET integrated database retrieval system