KEGG   Candidatus Liberibacter solanacearum: CKC_01465Help
Entry
CKC_01465         CDS       T01373                                 

Definition
acetyl-CoA carboxylase subunit beta
Orthology
K01963  
acetyl-CoA carboxylase carboxyl transferase subunit beta [EC:6.4.1.2]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Carbon metabolism [PATH:lso01200]
Metabolism; Overview; Fatty acid metabolism [PATH:lso01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lso00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lso00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:lso00061]
Metabolism; Metabolism of terpenoids and polyketides; Tetracycline biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
287628..288479
Genome map
AA seq 283 aa AA seqDB search
MNWITNFVRPRISSVFGRSSIPENLWVKCPETGEMIYHKDLEENQRVILSSGFHMKIPAK
ERLNFLFDNGEYSLLDQPQTCQDPLKFRDNKKYIDRLKENRSKTNLVDSVISAIGNVHGL
KLVAVVHDFSFIGGSLGMAAGEIIIKSFEKAIEEQCPLVMFTASGGARMQEGILSLMQLP
RTTIAVGMLKEAGLPYIVVLTNPTTGGVTASYAMLGDIHLAEPGAEIGFAGKRVIEQTVR
EKLPDGFQRSEYLVEHGMIDKIVHRHDIPKTLYTLCKILTKKT
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgaactggatcacaaattttgttcgtcctcgtataagttctgtattcggacgtagctca
attccggaaaatctttgggtaaaatgtccggaaacaggagaaatgatttatcacaaagat
ctagaagaaaaccaaagggttatactttcttctggttttcatatgaaaataccggcaaaa
gaaagattgaatttcttgtttgataacggggaatactctttgttagatcaacctcaaaca
tgtcaagatccattgaaatttcgtgataataaaaaatacatagatcgcttaaaagaaaat
cgttctaaaaccaatttggtggattcagtcatatcagctattggtaatgtacatggttta
aaattagttgccgttgtgcatgatttttcttttatagggggatcgttaggtatggctgca
ggtgaaataatcataaaatcttttgaaaaagctattgaggaacaatgccctcttgtaatg
tttactgcatctggtggtgcacgcatgcaagaaggtattttgtcacttatgcaattgcct
cgtaccacaattgcggttggcatgcttaaagaagcgggtcttccttatattgtcgtcctg
actaatcctacaacaggaggcgttactgcttcctatgctatgcttggcgatattcattta
gctgagcctggagccgaaataggtttcgctgggaaaagagtgattgaacagacagtaaga
gaaaaattgccagatggttttcaaagatctgaatatctagtggaacatggaatgatagat
aaaatagttcataggcatgatattccaaaaactctatatacattatgtaaaatattgacc
aaaaaaacgtag

DBGET integrated database retrieval system