KEGG   Candidatus Liberibacter solanacearum: CKC_01680Help
Entry
CKC_01680         CDS       T01373                                 

Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CKC_01680
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CKC_01680
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CKC_01680
Enzymes [BR:lso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CKC_01680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
344475..345878
Genome map
AA seq 467 aa AA seqDB search
MKYISTRNVDLNIGFCDAILSGLAEDGGLYIPKDIPYFSEKEIRNLRGLSYEEIAQFIFL
PFVGEEIESSKLQEIVNRAYHCFRNAAVTPLVQLDKNDFLLELFHGPTLSFKDIAMQLLA
ELIDHILEERDQYITIVGATSGDTGAAAIKAFAGKKRVKVCILFPKGRVSLVQQKQMTTS
RAFNVDIIAIEGSFDDCQKIVKNLFADVHFRNSVNLSGINSINWARIMAQIVYYFVSAIV
LGAPDRKISFSVPTGNFGDIFAGYFAKLMGLPIEQLIIATNENDTLVRMLNTGIYKPETV
KETTSPAMDIQISSNFERLLFEISGRDSVLVKKAFDSLENQQYFQIYPEHLQKISCLFSA
RSASQKDVNDVIHSVLENSSYLLDPHTAVGIHAALACRKTLSTPMVTLATAHPAKFPDIV
KMASSITPNCPVFLQQTMKRPESFKLMSNNIEQVKEFIKNKKRGDRN
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgaaatatatttccacgcgcaatgttgatctgaatattggtttttgtgatgcaatcctt
tctggattagcagaagatggaggattgtatattccaaaagatattccttatttttcagaa
aaagagattagaaatttgcggggtttaagctatgaagaaatagcacaatttatttttctt
ccttttgttggggaagagattgaatctagcaaacttcaggaaatagtgaatagagcgtac
cattgttttcgtaatgctgcggttacaccacttgttcaattagataaaaatgacttcttg
ttagaattgtttcatggtccgactttatcatttaaagatatagccatgcaattacttgca
gaattgattgatcatattttagaagaaagagatcagtatattacaatagtaggggcgact
tctggggatacgggtgctgctgctatcaaggcatttgcaggaaagaaaagagttaaagtt
tgtattcttttcccaaagggaagagtttctcttgttcagcaaaaacaaatgacgacttct
agagcatttaatgttgatattatagctatcgaaggtagttttgatgattgtcaaaaaata
gttaaaaatctattcgcagatgttcattttcgtaattcagtcaatttatcgggaattaat
tcaataaattgggctcgtattatggctcaaattgtttattactttgtttctgctattgta
ctgggcgctccagatcgtaagatttcttttagtgttccaacgggtaattttggtgatatt
tttgcaggatattttgcaaaattaatgggtcttcctatagaacaattaattatagccacc
aatgaaaatgacacactggttcgtatgttaaatacgggtatatataagccggagacagta
aaggagacgacatctcctgcaatggatatacaaatatcttctaatttcgaaagattgcta
tttgaaattagtgggagggattctgttcttgtaaaaaaagcatttgattccctggaaaat
caacaatactttcaaatttatccggagcatttgcaaaaaatatcttgtcttttttctgct
agaagtgcttctcagaaagatgtcaatgatgttattcattccgttttagagaattctagt
tatcttctggacccacatacagctgttggtatccatgctgcattagcgtgtagaaagacc
ttatcaacgccaatggtaacacttgctacagcacatcctgcaaaatttccagatattgta
aaaatggcttcaagtataactccaaattgtcctgtgtttttacaacaaactatgaaaaga
cctgaaagttttaaattaatgagtaataatatagagcaagttaaagagtttatcaaaaac
aagaaacgtggagatcgaaattga

DBGET integrated database retrieval system