KEGG   Candidatus Liberibacter solanacearum: CKC_02045Help
Entry
CKC_02045         CDS       T01373                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKC_02045
   01230 Biosynthesis of amino acids
    CKC_02045
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CKC_02045
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CKC_02045
Enzymes [BR:lso01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CKC_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438227..440209
Genome map
AA seq 660 aa AA seqDB search
MRCDGYKKMANAIRFLSMDAIENVNSGHPGLPMGMADVITVLFSQFMAFDPKCPSWPNRD
RFVLSAGHGSMLYYSLLYLLGYQDITIDDIKKFRTIGSKTAGHPEYGFLSGIEATTGPLG
QGIANAVGMAIAERKLRDEFSDALINHYTYVLVGDGCLMEGISQEAISLAGHLGLNKLIV
LWDNNGISIDGSISLADSTDQHARFRASGWNTLSVNGHDYNAIASILREAQESNKPTMIA
CETVIGFGSPNKAGTNKVHGSALGKEEIKATRKALNWNLDPFLIPDEIMKEWRSVGLRSS
QIRADWQSHLSSIESDVQKEFNRRFSDELPDCFDNTIMQLKKKIGESKPEVATRKSSEMV
LEVINDCLPEIIGGSADLTGSNGTKTSQMKSISRSDFSGRYLHYGVREHAMAAVMNGIAL
HKGLVPYSGTFMVFSDYSRPSIRLASLMGIRVVHVLTHDSIGVGEDGPTHQPVEHMAALR
AIPNLLVFRPADSIETLECWQVALKKKSCPSVLSLSRQNLPFLRTQYEEKNLCSLGAYDY
IACPNAQVAIFASGSELKIAVEARNLLSARNISARVISVPCFELFFEQSDAYRAQIIGTS
PVKIAVEAGLRQGWDSLIGSDGDFVGMKGFGSSGSCDLLYQHFGITATAIVALVERKLLT
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcgatggatataaaaagatggctaatgccattaggtttttgtcaatggatgct
atagagaacgtcaattctgggcatccaggattgcctatgggaatggcagatgtgatcact
gttcttttctcacaattcatggcgtttgatcctaaatgtccatcatggccaaatcgtgat
cgttttgttttgtcagcggggcatggctccatgttgtattactcattgctctatctttta
gggtatcaggacataacaattgatgacatcaaaaaatttcgaacaattggctctaaaaca
gcagggcatcctgaatatggatttctttctggaattgaggctactaccggacctttaggg
caaggaattgccaatgctgtcggcatggctattgccgagcgtaaattaagagatgaattt
agtgatgcattgatcaatcattatacttatgtattggtcggtgatggttgtttgatggaa
ggtattagtcaagaagcgatttctttagcagggcatcttggattaaataaactgatcgtt
ctttgggataataatggtatttcaattgatggttctatttccttagctgattctacagat
cagcatgctcgtttccgtgcgtctggatggaatacattgtctgttaatggacatgattat
aatgctattgcatctatcttgagagaagcccaagaatccaacaaacctacgatgattgct
tgtgagacggttattggttttggatctccaaataaagcggggacgaataaagtccatggt
tctgctttgggtaaagaagaaataaaagctactcgtaaggctctgaattggaatttagat
ccttttttgattcctgatgaaataatgaaagaatggcgttcggttggattacgctcttct
caaataagggcagattggcaatcccatctttcttctattgagagtgatgtgcaaaaagaa
tttaatcgtcgtttttcagatgaattgcctgattgttttgataatactattatgcaattg
aagaaaaagattggggaatctaagccagaagttgctacacgcaaatcttctgaaatggta
ctagaagtgattaatgattgtttgccagagatcatcggaggatcggcagatcttactggt
tctaacggcacgaaaaccagtcaaatgaaatctatttctaggagtgatttttcaggtcgt
tacttacactatggtgtgcgtgaacatgctatggctgcggtgatgaatggcatagcattg
cataagggattagtgccatactcgggaacgtttatggtattttctgattacagtcgccct
tctataaggttggcgtctttaatgggaataagggttgttcatgttttaacacatgattct
ataggggtaggtgaagatggacctacacatcaacccgtagaacatatggcggcattgaga
gctatacctaatcttcttgtttttagacctgcggattcgatagaaacattagaatgttgg
caggtagctcttaagaagaaaagttgtccatctgtattatctttgtctagacaaaatttg
ccttttctccgtactcaatatgaagaaaaaaatttatgttctttaggtgcttatgattat
attgcttgtcctaatgcacaagtagcgatttttgcttcaggttctgaattaaagattgct
gtagaagcgcgtaatcttttatctgctaggaatatttctgctcgtgtgatttcagttcct
tgttttgaattgttttttgaacaatcagacgcataccgtgcacaaattatagggacatct
cccgttaagattgctgttgaggcaggattgcgtcaagggtgggattctttgataggaagt
gatggggattttgttggcatgaaaggttttggatcttcaggatcttgcgatcttctttat
caacattttggtataactgctactgcaatagtggctttggtggagaggaaattattaaca
taa

DBGET integrated database retrieval system