KEGG   Candidatus Liberibacter solanacearum: CKC_02045Help
Entry
CKC_02045         CDS       T01373                                 

Definition
transketolase
Orthology
K00615  
transketolase [EC:2.2.1.1]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKC_02045
   01230 Biosynthesis of amino acids
    CKC_02045
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CKC_02045
  Metabolism of terpenoids and polyketides
   01051 Biosynthesis of ansamycins
    CKC_02045
Enzymes [BR:lso01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.1  transketolase
     CKC_02045
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
438227..440209
Genome map
AA seq 660 aa AA seqDB search
MRCDGYKKMANAIRFLSMDAIENVNSGHPGLPMGMADVITVLFSQFMAFDPKCPSWPNRD
RFVLSAGHGSMLYYSLLYLLGYQDITIDDIKKFRTIGSKTAGHPEYGFLSGIEATTGPLG
QGIANAVGMAIAERKLRDEFSDALINHYTYVLVGDGCLMEGISQEAISLAGHLGLNKLIV
LWDNNGISIDGSISLADSTDQHARFRASGWNTLSVNGHDYNAIASILREAQESNKPTMIA
CETVIGFGSPNKAGTNKVHGSALGKEEIKATRKALNWNLDPFLIPDEIMKEWRSVGLRSS
QIRADWQSHLSSIESDVQKEFNRRFSDELPDCFDNTIMQLKKKIGESKPEVATRKSSEMV
LEVINDCLPEIIGGSADLTGSNGTKTSQMKSISRSDFSGRYLHYGVREHAMAAVMNGIAL
HKGLVPYSGTFMVFSDYSRPSIRLASLMGIRVVHVLTHDSIGVGEDGPTHQPVEHMAALR
AIPNLLVFRPADSIETLECWQVALKKKSCPSVLSLSRQNLPFLRTQYEEKNLCSLGAYDY
IACPNAQVAIFASGSELKIAVEARNLLSARNISARVISVPCFELFFEQSDAYRAQIIGTS
PVKIAVEAGLRQGWDSLIGSDGDFVGMKGFGSSGSCDLLYQHFGITATAIVALVERKLLT
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgcggtgcgatggatataaaaagatggctaatgccattaggtttttgtcaatggatgct
atagagaacgtcaattctgggcatccaggattgcctatgggaatggcagatgtgatcact
gttcttttctcacaattcatggcgtttgatcctaaatgtccatcatggccaaatcgtgat
cgttttgttttgtcagcggggcatggctccatgttgtattactcattgctctatctttta
gggtatcaggacataacaattgatgacatcaaaaaatttcgaacaattggctctaaaaca
gcagggcatcctgaatatggatttctttctggaattgaggctactaccggacctttaggg
caaggaattgccaatgctgtcggcatggctattgccgagcgtaaattaagagatgaattt
agtgatgcattgatcaatcattatacttatgtattggtcggtgatggttgtttgatggaa
ggtattagtcaagaagcgatttctttagcagggcatcttggattaaataaactgatcgtt
ctttgggataataatggtatttcaattgatggttctatttccttagctgattctacagat
cagcatgctcgtttccgtgcgtctggatggaatacattgtctgttaatggacatgattat
aatgctattgcatctatcttgagagaagcccaagaatccaacaaacctacgatgattgct
tgtgagacggttattggttttggatctccaaataaagcggggacgaataaagtccatggt
tctgctttgggtaaagaagaaataaaagctactcgtaaggctctgaattggaatttagat
ccttttttgattcctgatgaaataatgaaagaatggcgttcggttggattacgctcttct
caaataagggcagattggcaatcccatctttcttctattgagagtgatgtgcaaaaagaa
tttaatcgtcgtttttcagatgaattgcctgattgttttgataatactattatgcaattg
aagaaaaagattggggaatctaagccagaagttgctacacgcaaatcttctgaaatggta
ctagaagtgattaatgattgtttgccagagatcatcggaggatcggcagatcttactggt
tctaacggcacgaaaaccagtcaaatgaaatctatttctaggagtgatttttcaggtcgt
tacttacactatggtgtgcgtgaacatgctatggctgcggtgatgaatggcatagcattg
cataagggattagtgccatactcgggaacgtttatggtattttctgattacagtcgccct
tctataaggttggcgtctttaatgggaataagggttgttcatgttttaacacatgattct
ataggggtaggtgaagatggacctacacatcaacccgtagaacatatggcggcattgaga
gctatacctaatcttcttgtttttagacctgcggattcgatagaaacattagaatgttgg
caggtagctcttaagaagaaaagttgtccatctgtattatctttgtctagacaaaatttg
ccttttctccgtactcaatatgaagaaaaaaatttatgttctttaggtgcttatgattat
attgcttgtcctaatgcacaagtagcgatttttgcttcaggttctgaattaaagattgct
gtagaagcgcgtaatcttttatctgctaggaatatttctgctcgtgtgatttcagttcct
tgttttgaattgttttttgaacaatcagacgcataccgtgcacaaattatagggacatct
cccgttaagattgctgttgaggcaggattgcgtcaagggtgggattctttgataggaagt
gatggggattttgttggcatgaaaggttttggatcttcaggatcttgcgatcttctttat
caacattttggtataactgctactgcaatagtggctttggtggagaggaaattattaaca
taa

DBGET integrated database retrieval system