KEGG   Candidatus Liberibacter solanacearum: CKC_02125Help
Entry
CKC_02125         CDS       T01373                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CKC_02125
   00052 Galactose metabolism
    CKC_02125
   00500 Starch and sucrose metabolism
    CKC_02125
   00520 Amino sugar and nucleotide sugar metabolism
    CKC_02125
Enzymes [BR:lso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CKC_02125
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
455988..456887
Genome map
AA seq 299 aa AA seqDB search
MESFKKIQKAVFPIAGFGMRFLPISKVVPKEMLAIVDKPVIQYVVEEALEAGLRHFVFVT
GRGKNLIEDYFDIQFELEQSLKKREKTAELTLLTEAVPKIENAVFTRQYERKGLGHAVWC
ARHIIGDDPFALLLPDMIISPFEGENCMKNMVQLYEKKGANIIAVSECDPKMSYKYGMVK
VGESVDDQAFLISDMVEKPNPDTFFSKFYINGRYILHPDIFGILENWKQQKDKGEINLTD
SMRQLSERQIFFAYHFKGRTYDCGSKEGFVLANIVFALARQDICSDIETDLKALVSALK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgtttaaaaagattcaaaaagctgtttttcctattgcgggctttggaatgcgt
tttcttcctatttctaaagtagttcctaaggaaatgctggctatagtggataagcctgtt
attcaatatgttgtagaggaagctttggaagctggattgcggcattttgtatttgttaca
ggacgtggaaaaaatttgatcgaagattatttcgacattcaatttgagttggaacaatct
cttaaaaaaagagaaaaaacagctgaattaacgttgttgacagaagctgttccaaaaatt
gaaaatgctgtatttacaagacaatatgagagaaaaggtctagggcatgcagtatggtgt
gctcggcatattattggagatgatccttttgctctgttgcttcccgatatgattatatct
ccttttgaaggggaaaattgtatgaaaaatatggtacaattatatgaaaaaaaaggcgca
aatattatagctgtttcagaatgtgatcctaaaatgtcctataaatatgggatggttaaa
gtaggagaatcagtagatgatcaagcttttcttatatccgacatggttgaaaagccaaat
ccagatacatttttttctaaattttatattaatggtcgctatattttacatcctgatatt
tttggaattttagaaaattggaagcaacagaaagataaaggtgaaataaatctcacagat
tctatgcgacagttgtctgaaaggcagattttttttgcatatcattttaaagggcgtaca
tatgattgtggctcgaaagaaggatttgttctcgcaaatattgtttttgctcttgctaga
caagatatttgctctgatatagagactgatctaaaggcgcttgtatccgcattgaaatag

DBGET integrated database retrieval system