KEGG   Candidatus Liberibacter solanacearum: CKC_02325Help
Entry
CKC_02325         CDS       T01373                                 

Definition
(GenBank) pyruvate dehydrogenase complex dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00010  Glycolysis / Gluconeogenesis
lso00020  Citrate cycle (TCA cycle)
lso00620  Pyruvate metabolism
lso01100  Metabolic pathways
lso01110  Biosynthesis of secondary metabolites
lso01120  Microbial metabolism in diverse environments
lso01130  Biosynthesis of antibiotics
lso01200  Carbon metabolism
Module
lso_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKC_02325
   00020 Citrate cycle (TCA cycle)
    CKC_02325
   00620 Pyruvate metabolism
    CKC_02325
Enzymes [BR:lso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CKC_02325
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADR52216
UniProt: E4UCX6
Position
complement(500902..502188)
Genome map
AA seq 428 aa AA seqDB search
MINTITMPSLSPTMKTGKLAKWLVKKGDKIYPGDIICEIETDKAIMEFESVDEGVVHEIL
TSEGTENIKVNSPILNILIDCDGGAPAPILPEKNFVEIEKESSDPAISSFAPTEKKVCGQ
DFPASSPLARRLAKENGIDLSSVSGSGPRGRIVKNDIEQLILHNTGVKHASTAQSASIES
MNSSVDDDIMRLFAPNSYEIIPHDNMRKTIASRLQQSKQTIPHFYVSIDCNIDNLLSLRQ
QMNLFAQSNKKENINKISVNDVILKAFSLAMLQVPEANVSWTTNALIRHKNIDISVAVSI
PGGLVTPIVRQVNKKSISDISLEVKQLVQRAKQRKLKPQEYQGGTTSVSNMGMFGISNFC
AVINPPQSTILAIGAGVQKPIFQNGAIKVVTIMNATLSADHRSVDGAVASKLLAKFKEYI
ENPAWMLL
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgataaatacaataactatgccttctttatccccaactatgaaaacaggtaaattggca
aaatggctggtaaaaaagggcgataaaatatatccaggagatattatctgtgaaattgaa
acagataaagcaatcatggagtttgaatctgtagatgaaggagtcgtgcacgaaatcctt
acctcagaaggaactgaaaacattaaggtgaatagtcctatattgaatattttgatagat
tgtgatgggggcgctcctgctcctattttgccagaaaaaaatttcgtcgaaatagaaaaa
gaatcctctgatcccgctatctcttcttttgcccccacagaaaaaaaagtatgcggacaa
gactttcccgcctcttcacctcttgcgcgtcgtcttgcaaaagaaaacggcattgacctt
tcatcggtctccggttctgggccacgcggtcgcatagttaaaaatgatattgaacagctt
attttacacaatacaggcgtcaaacatgcatcaaccgcacaatctgcaagtatagaatcg
atgaattcatctgttgatgacgatattatgagactctttgcccctaattcctatgagatc
atcccgcatgataacatgcgcaaaactattgcttctcgacttcagcaatctaaacagact
ataccgcatttctatgtgtctattgattgtaatattgataatcttctttctttaagacag
caaatgaatctatttgcacaatctaataaaaaggaaaatattaacaagatttctgtaaat
gatgtgattttaaaggctttttccttagcaatgttacaagttccagaagctaatgtttct
tggacgacaaatgctctcattcgtcataagaatattgacatcagcgttgccgtaagcatt
ccaggagggcttgtgacccctattgttcgtcaagtaaataaaaaaagtatttctgatatt
tctttggaagttaaacagctcgttcaacgagccaaacaacgaaaacttaaaccccaagaa
tatcaagggggaacaacttcggtatccaatatgggtatgtttggtatcagtaatttttgc
gctgtgattaatccacctcaatcaacgatcctcgctataggagctggagtgcagaaacct
atattccagaatggtgcaataaaagtagtaacgatcatgaacgccactctatcagcagat
catcgttcagttgatggagctgttgcgtcaaaattattagctaaatttaaagaatacata
gaaaatcctgcttggatgttactatag

DBGET integrated database retrieval system