KEGG   Candidatus Liberibacter solanacearum: CKC_03135Help
Entry
CKC_03135         CDS       T01373                                 

Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00860  Porphyrin and chlorophyll metabolism
lso01100  Metabolic pathways
lso01110  Biosynthesis of secondary metabolites
lso01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CKC_03135
Enzymes [BR:lso01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CKC_03135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADR52376
UniProt: E4UAY5
Position
complement(672904..673533)
Genome map
AA seq 209 aa AA seqDB search
MMPLSYFTYDREAVSLALQESYGGIAITSSESLSTLPDKFCHNSILFSIGEASASLARTK
GFSQIFCGKNNSISLAQLIVQKKELFTPQKPLIYLGGKKRKIHFENYLFQHRIPFKTIDC
YYSWNIVYSKKEVERIIKSADAVLFYASSSVSNFFLLPLPIKISVRFLCLSQNIASEIPV
SFTDLVSVAEFPKESSLLELLLSLQSQKP
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgatgcctctatcctattttacttatgatagagaggcggtatctcttgccttgcaagaa
tcctatggaggaatagcaataaccagcagcgaatctctctccacattacccgataaattt
tgtcataatagcattcttttttccataggagaagcgagtgcttctctcgcacgaacaaaa
ggattttctcaaatattttgcggaaagaataacagtattagtctggctcaattaattgtc
caaaaaaaagaattattcacccctcaaaagcccttgatatacttaggagggaaaaaaaga
aagatccattttgaaaattatctttttcaacacagaatccccttcaaaaccattgattgc
tattatagttggaatattgtatattctaagaaggaagtagagcgtataattaaaagcgca
gatgctgtgctgttttatgcaagttcttctgtgtcaaattttttccttttgcccttacct
ataaaaatatctgtacgcttcttatgtttaagccaaaatattgcttccgaaattcccgtc
tcattcacagatctagtttcagtggcagagtttccaaaagaatcctctttgctagagctt
cttctttcattacaatcacaaaagccttga

DBGET integrated database retrieval system