KEGG   Candidatus Liberibacter solanacearum: CKC_03165Help
Entry
CKC_03165         CDS       T01373                                 

Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00020  Citrate cycle (TCA cycle)
lso00190  Oxidative phosphorylation
lso00650  Butanoate metabolism
lso01100  Metabolic pathways
lso01110  Biosynthesis of secondary metabolites
lso01120  Microbial metabolism in diverse environments
lso01130  Biosynthesis of antibiotics
lso01200  Carbon metabolism
Module
lso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
lso_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKC_03165
   00650 Butanoate metabolism
    CKC_03165
  Energy metabolism
   00190 Oxidative phosphorylation
    CKC_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS DUF2474 Ceramidase
Motif
Other DBs
NCBI-ProteinID: ADR52382
UniProt: E4UAZ1
Position
678021..678407
Genome map
AA seq 128 aa AA seqDB search
MNMRSSLGKVRGMGSAKDGTGHFLKQRFTAIANIPFVIFFIIFFIRYGSAPHEQIVSVVS
NLFVASIMGLGAVSIFFHMQLGMQVIIEDYVHSKLLKIVLLMLNSSFVLFMAVFCLFSIL
KISILGNQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgtagtagcttaggaaaagtacgagggatgggttccgctaaagatggtacg
ggacactttttaaaacaaaggttcactgctattgccaatattccttttgttatctttttt
ataatattttttataaggtatggttctgctccgcatgaacagattgtttctgttgtttct
aatctttttgtagcatctataatgggattaggggcggtttcaattttttttcatatgcaa
cttggtatgcaggtgattattgaagattatgttcattctaaattattaaagatagtgctt
cttatgttaaacagttcttttgttttgtttatggcggttttttgtttgttttctatttta
aaaatttcaattttgggtaatcaatga

DBGET integrated database retrieval system