KEGG   Candidatus Liberibacter solanacearum: CKC_03165Help
Entry
CKC_03165         CDS       T01373                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKC_03165
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKC_03165
   00650 Butanoate metabolism
    CKC_03165
  Energy metabolism
   00190 Oxidative phosphorylation
    CKC_03165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
678021..678407
Genome map
AA seq 128 aa AA seqDB search
MNMRSSLGKVRGMGSAKDGTGHFLKQRFTAIANIPFVIFFIIFFIRYGSAPHEQIVSVVS
NLFVASIMGLGAVSIFFHMQLGMQVIIEDYVHSKLLKIVLLMLNSSFVLFMAVFCLFSIL
KISILGNQ
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgaatatgcgtagtagcttaggaaaagtacgagggatgggttccgctaaagatggtacg
ggacactttttaaaacaaaggttcactgctattgccaatattccttttgttatctttttt
ataatattttttataaggtatggttctgctccgcatgaacagattgtttctgttgtttct
aatctttttgtagcatctataatgggattaggggcggtttcaattttttttcatatgcaa
cttggtatgcaggtgattattgaagattatgttcattctaaattattaaagatagtgctt
cttatgttaaacagttcttttgttttgtttatggcggttttttgtttgttttctatttta
aaaatttcaattttgggtaatcaatga

DBGET integrated database retrieval system