KEGG   Candidatus Liberibacter solanacearum: CKC_03195Help
Entry
CKC_03195         CDS       T01373                                 

Definition
(GenBank) succinyl-CoA synthetase subunit beta
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00020  Citrate cycle (TCA cycle)
lso00640  Propanoate metabolism
lso01100  Metabolic pathways
lso01110  Biosynthesis of secondary metabolites
lso01120  Microbial metabolism in diverse environments
lso01130  Biosynthesis of antibiotics
lso01200  Carbon metabolism
Module
lso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKC_03195
   00640 Propanoate metabolism
    CKC_03195
   00660 C5-Branched dibasic acid metabolism
    CKC_03195
Enzymes [BR:lso01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CKC_03195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADR52388
UniProt: E4UAZ7
Position
683913..685109
Genome map
AA seq 398 aa AA seqDB search
MDIHEYQAKALLKRYGIPVAEGVVVSSIHEADSAIKTLPGGLYVVKSQIHAGGRGKGRFR
GLPANSRGGVRLEKSIEGVLSDVREMLGSILVTKQTGPAGSKVNCLYIEDGADILKELYL
SLLVDRVSGKITFVASTQGGMDIEEVAKDYPQKIFKLPIDSLVGVTPKDIGNLCDMLELK
GQARIDAESLFPNLYKAFCDKDMSLLEINPLIIMQNGRLRVLDSKVSFDDNALYRQLDIQ
ELHDDSEEDVREIEARKHGLSYITLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVG
GGTDQDKVAAAFKIIMLDSSVKGILINIFGGIVRCDVLVKGILSAVKDVNVNIPLVMRLE
GAKVDIGNQLIVESGLNVITAIDLDDAAQKIVRAVKGV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggatattcatgaatatcaagctaaggcattgttaaaaagatatggtattccggttgcc
gagggtgtggttgtatcgtctattcatgaggcggattctgcaatcaaaactcttcctggt
ggattgtatgtcgtcaagagtcagattcatgctggagggcgcggtaaagggcgattcaga
ggattgcctgctaattcacgaggtggggtgcgtttagaaaaatctattgaaggtgttttg
tctgatgttcgtgagatgcttggttctatcctcgtaacaaagcaaactggtcctgcaggt
agtaaggtaaattgtttgtatattgaagatggagctgatattttaaaagaactctatctt
tctctcttggtggatagagtatcaggaaagattacttttgttgcttctactcaaggaggc
atggatattgaagaagttgctaaagattatcctcagaagatattcaaacttcctattgat
tctttggtaggggtgacacctaaagatatcggtaatttatgtgatatgcttgaattaaaa
gggcaggctcgtattgatgctgaaagtctttttcctaacctttataaagctttttgtgat
aaggatatgagtcttttggaaattaatccattgattattatgcaaaatggtcgtttgagg
gtattagattcgaaagtctcgtttgatgataatgcgctctatcgtcagttagatattcag
gaattacatgatgattcagaggaggatgtccgagagatagaggctagaaagcatggtctt
tcttatataacacttgatggtaatatcggctgtatggttaatggtgctggtttagctatg
gcgaccatggatatcattaaattatacggaggagagcctgctaattttcttgatgttggg
ggtggaacagatcaagataaagtagctgctgcttttaagatcattatgttagattcttct
gtcaaaggtatattgattaatatatttggagggattgtgagatgtgatgttttagtcaaa
gggattttgtctgctgttaaggacgttaatgtcaatattcctcttgttatgcgtcttgaa
ggggctaaagtagatattgggaatcaattgattgtagagagtggtttgaatgttatcacg
gcaattgatttagatgatgctgctcagaaaatagttcgtgcagtgaaaggagtttga

DBGET integrated database retrieval system