KEGG   Candidatus Liberibacter solanacearum: CKC_03195Help
Entry
CKC_03195         CDS       T01373                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:lso01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:lso00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:lso00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
683913..685109
Genome map
AA seq 398 aa AA seqDB search
MDIHEYQAKALLKRYGIPVAEGVVVSSIHEADSAIKTLPGGLYVVKSQIHAGGRGKGRFR
GLPANSRGGVRLEKSIEGVLSDVREMLGSILVTKQTGPAGSKVNCLYIEDGADILKELYL
SLLVDRVSGKITFVASTQGGMDIEEVAKDYPQKIFKLPIDSLVGVTPKDIGNLCDMLELK
GQARIDAESLFPNLYKAFCDKDMSLLEINPLIIMQNGRLRVLDSKVSFDDNALYRQLDIQ
ELHDDSEEDVREIEARKHGLSYITLDGNIGCMVNGAGLAMATMDIIKLYGGEPANFLDVG
GGTDQDKVAAAFKIIMLDSSVKGILINIFGGIVRCDVLVKGILSAVKDVNVNIPLVMRLE
GAKVDIGNQLIVESGLNVITAIDLDDAAQKIVRAVKGV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggatattcatgaatatcaagctaaggcattgttaaaaagatatggtattccggttgcc
gagggtgtggttgtatcgtctattcatgaggcggattctgcaatcaaaactcttcctggt
ggattgtatgtcgtcaagagtcagattcatgctggagggcgcggtaaagggcgattcaga
ggattgcctgctaattcacgaggtggggtgcgtttagaaaaatctattgaaggtgttttg
tctgatgttcgtgagatgcttggttctatcctcgtaacaaagcaaactggtcctgcaggt
agtaaggtaaattgtttgtatattgaagatggagctgatattttaaaagaactctatctt
tctctcttggtggatagagtatcaggaaagattacttttgttgcttctactcaaggaggc
atggatattgaagaagttgctaaagattatcctcagaagatattcaaacttcctattgat
tctttggtaggggtgacacctaaagatatcggtaatttatgtgatatgcttgaattaaaa
gggcaggctcgtattgatgctgaaagtctttttcctaacctttataaagctttttgtgat
aaggatatgagtcttttggaaattaatccattgattattatgcaaaatggtcgtttgagg
gtattagattcgaaagtctcgtttgatgataatgcgctctatcgtcagttagatattcag
gaattacatgatgattcagaggaggatgtccgagagatagaggctagaaagcatggtctt
tcttatataacacttgatggtaatatcggctgtatggttaatggtgctggtttagctatg
gcgaccatggatatcattaaattatacggaggagagcctgctaattttcttgatgttggg
ggtggaacagatcaagataaagtagctgctgcttttaagatcattatgttagattcttct
gtcaaaggtatattgattaatatatttggagggattgtgagatgtgatgttttagtcaaa
gggattttgtctgctgttaaggacgttaatgtcaatattcctcttgttatgcgtcttgaa
ggggctaaagtagatattgggaatcaattgattgtagagagtggtttgaatgttatcacg
gcaattgatttagatgatgctgctcagaaaatagttcgtgcagtgaaaggagtttga

DBGET integrated database retrieval system