KEGG   Candidatus Liberibacter solanacearum: CKC_03210Help
Entry
CKC_03210         CDS       T01373                                 

Definition
(GenBank) dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
lso00020  Citrate cycle (TCA cycle)
lso00310  Lysine degradation
lso01100  Metabolic pathways
lso01110  Biosynthesis of secondary metabolites
lso01120  Microbial metabolism in diverse environments
lso01130  Biosynthesis of antibiotics
lso01200  Carbon metabolism
Module
lso_M00009  Citrate cycle (TCA cycle, Krebs cycle)
lso_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKC_03210
  Amino acid metabolism
   00310 Lysine degradation
    CKC_03210
Enzymes [BR:lso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CKC_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADR52391
UniProt: E4UB00
Position
689059..690288
Genome map
AA seq 409 aa AA seqDB search
MATKILVPSLGESVSEATVGTWSKKVGDFVEIGETLVDLETDKVSIEVPSPVSGELTDIS
VATGEIVIAGGFLGYVSEVSGQKSIKKKSSHSIASDIVERVGYHMPQSPSAAKLIAESGM
SLSDITGTGKRGQILKSDVETAISNTVSSSDKSRLSSVDTSNILVKQSNNGSNIAGEESE
ERVKMSRLRHTVAKRLKDSQNTAAILSTYNEVNMSRILSIRSCYKEIFEKKHGIKLGFMG
FFTKAVSQALQEIRGVNAEIDGDYIVYKNYCHIGVAVGTDKGLVVPVVRHAEKMSLVDIE
REIARLGQEARAGNLSMRDLQDGTFTISNGGVYGSLLSAPILNPPQSGILGMHKIQERPI
VEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRIKELLEDPERFILDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctacgaaaattttggtgccttctttgggggaatccgtcagcgaagcaacggttggt
acttggtctaaaaaagttggtgattttgtggaaattggtgaaactttagtagaccttgaa
actgacaaggtgagcattgaggtgccttctcctgtttcgggagaattgaccgatatttcg
gttgctacgggtgaaatagtgattgctggtggttttctgggatatgtttcagaagtttca
gggcagaaatctataaagaagaaatcttctcattctattgctagtgatatagttgaacga
gtcggatatcatatgcctcaatctccatctgcggctaaattaatagcagaatctggtatg
tcattgtctgatattacggggacgggaaaaagaggtcagatattaaagtctgacgttgag
acggcaatttctaatactgtatcctcttctgataaatcgagattatcttcggttgataca
agtaatattttagttaaacagtctaataacggctctaatattgcgggagaagaaagtgaa
gagcgggttaaaatgtctcgtttgcgtcatactgttgctaaacgattgaaagattctcaa
aatactgctgctattttgagtacttataatgaagtaaacatgtctcgcattctttctatt
cgctcttgttataaagagatttttgagaaaaaacatgggatcaaattaggttttatgggt
ttttttactaaagcagtaagtcaggctcttcaggaaattaggggggttaatgcagagatt
gatggagactatatcgtttataagaattactgccacattggggtagcagttgggacagat
aaaggtcttgttgttccggttgtgcgtcatgcagagaagatgagtcttgtggatattgaa
agagaaatagctcgtcttggtcaagaagcgcgtgcaggaaatctttccatgcgtgatttg
caagatggtacatttacaatatcgaatggtggggtttatggttctctcttgtctgctcca
atattgaatccgccgcaatcaggtattttgggtatgcataagattcaagaaaggccaata
gtagaagacggacaaatcgtgattcgtcctatgatgtatcttgctttatcatatgatcat
cgtatcgtagatggtaaagaagctgtaacatttttggttcgcattaaggaattacttgaa
gatcctgagcgttttatattggatctataa

DBGET integrated database retrieval system