KEGG   Candidatus Liberibacter solanacearum: CKC_03210Help
Entry
CKC_03210         CDS       T01373                                 

Definition
dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKC_03210
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CKC_03210
  Amino acid metabolism
   00310 Lysine degradation
    CKC_03210
Enzymes [BR:lso01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CKC_03210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
689059..690288
Genome map
AA seq 409 aa AA seqDB search
MATKILVPSLGESVSEATVGTWSKKVGDFVEIGETLVDLETDKVSIEVPSPVSGELTDIS
VATGEIVIAGGFLGYVSEVSGQKSIKKKSSHSIASDIVERVGYHMPQSPSAAKLIAESGM
SLSDITGTGKRGQILKSDVETAISNTVSSSDKSRLSSVDTSNILVKQSNNGSNIAGEESE
ERVKMSRLRHTVAKRLKDSQNTAAILSTYNEVNMSRILSIRSCYKEIFEKKHGIKLGFMG
FFTKAVSQALQEIRGVNAEIDGDYIVYKNYCHIGVAVGTDKGLVVPVVRHAEKMSLVDIE
REIARLGQEARAGNLSMRDLQDGTFTISNGGVYGSLLSAPILNPPQSGILGMHKIQERPI
VEDGQIVIRPMMYLALSYDHRIVDGKEAVTFLVRIKELLEDPERFILDL
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atggctacgaaaattttggtgccttctttgggggaatccgtcagcgaagcaacggttggt
acttggtctaaaaaagttggtgattttgtggaaattggtgaaactttagtagaccttgaa
actgacaaggtgagcattgaggtgccttctcctgtttcgggagaattgaccgatatttcg
gttgctacgggtgaaatagtgattgctggtggttttctgggatatgtttcagaagtttca
gggcagaaatctataaagaagaaatcttctcattctattgctagtgatatagttgaacga
gtcggatatcatatgcctcaatctccatctgcggctaaattaatagcagaatctggtatg
tcattgtctgatattacggggacgggaaaaagaggtcagatattaaagtctgacgttgag
acggcaatttctaatactgtatcctcttctgataaatcgagattatcttcggttgataca
agtaatattttagttaaacagtctaataacggctctaatattgcgggagaagaaagtgaa
gagcgggttaaaatgtctcgtttgcgtcatactgttgctaaacgattgaaagattctcaa
aatactgctgctattttgagtacttataatgaagtaaacatgtctcgcattctttctatt
cgctcttgttataaagagatttttgagaaaaaacatgggatcaaattaggttttatgggt
ttttttactaaagcagtaagtcaggctcttcaggaaattaggggggttaatgcagagatt
gatggagactatatcgtttataagaattactgccacattggggtagcagttgggacagat
aaaggtcttgttgttccggttgtgcgtcatgcagagaagatgagtcttgtggatattgaa
agagaaatagctcgtcttggtcaagaagcgcgtgcaggaaatctttccatgcgtgatttg
caagatggtacatttacaatatcgaatggtggggtttatggttctctcttgtctgctcca
atattgaatccgccgcaatcaggtattttgggtatgcataagattcaagaaaggccaata
gtagaagacggacaaatcgtgattcgtcctatgatgtatcttgctttatcatatgatcat
cgtatcgtagatggtaaagaagctgtaacatttttggttcgcattaaggaattacttgaa
gatcctgagcgttttatattggatctataa

DBGET integrated database retrieval system