KEGG   Candidatus Liberibacter solanacearum: CKC_04065Help
Entry
CKC_04065         CDS       T01373                                 

Definition
deoxyribodipyrimidine photolyase
Orthology
K01669  
deoxyribodipyrimidine photo-lyase [EC:4.1.99.3]
Organism
lso  Candidatus Liberibacter solanacearum
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
850497..851930
Genome map
AA seq 477 aa AA seqDB search
MSVHLVWLRNDLRITDNKALYAACKNPNAKVIAVFIATPQQWNQHGMSARQATFIYATLL
QVQQSLSKRGIVLQYHQCSHFDDAIKWLDVYCQEKKVTELFYNRQYEINEHRRDQELERR
LKNRVICRGFDDSVLLPPGKIFNRACEMYKIYTPFRKEFIQNLTQSDLRSVPAPTIRQTG
PVILTKVPLYFDYPFQEVDPIFPIGEYNALQILRKFCKEKVQYYVEQRDIPAIQGTSHLS
PYLSIGALSPRQCWNRLNVEFSDVLIKTNSGAFSWLNELIWREFYHHLIVFYPSLCTGKP
FIQWTDKIEWNNDPRALEVWKQGNTGFPLVDAAMRQLNTMGWMHNRLRMITASFLVKDLL
IDWRIGEKYFMSQLLDGNLASNNGGWQWAASTGHDSVPYFRIFNPTTQGKRFDPKGIFIR
QWLPELKNVPDQYIHTPHNWIDNKNTIHPYPHPIVDHKQARQHTISKYSIAQKQSIA
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagcgttcatctcgtttggctacgcaacgatcttcgtattacagataacaaggcactt
tatgctgcttgtaaaaatccaaatgcaaaagtaattgccgtttttattgccacaccacaa
caatggaaccaacatggaatgtcggcacgtcaagctacttttatctatgccacgctttta
caagtacagcaatccctttctaagagaggaattgttctccaatatcaccaatgttctcat
tttgatgatgcgataaaatggttagatgtttattgccaagaaaaaaaagtaaccgaactt
ttttacaatcgccaatatgaaattaatgaacatcgtcgtgatcaggaattagaacgacgc
ctaaagaatagagttatttgtagaggatttgatgacagtgttcttcttccaccaggtaaa
atattcaatcgagcctgcgaaatgtacaagatatatacaccatttcgcaaagaatttatc
caaaatttaactcaatcagatctgcgttctgttccagcccctacaattcgtcaaactgga
cctgtcatcctaacaaaagttcctctatattttgattatccttttcaggaagtagatcct
attttccctattggagaatacaacgcattacagattttgcgcaaattttgtaaagaaaaa
gtacaatattatgttgaacaacgagatatccccgccattcaagggacgagtcatttatcc
ccctatttatctattggagctctttctcctcgccaatgttggaatagattaaatgtagaa
ttttcagatgtacttatcaaaaccaatagcggtgcttttagttggcttaatgaactgata
tggcgtgaattttatcatcatttaattgtgttttatccttctttatgcacgggcaaaccc
tttattcaatggactgataaaatagagtggaacaatgacccacgagctttagaagtatgg
aaacaaggtaatacagggtttcctcttgttgatgcagcaatgcgtcaactcaatacaatg
ggatggatgcataatcgtctacgcatgatcacagcaagttttttggtaaaagatcttttg
atagattggcggataggagaaaaatattttatgtcgcaattattagacggtaatttagcg
tcaaataacggaggatggcaatgggcagcttctacgggacatgattctgttccttacttt
cgtatttttaatcctactacccaaggaaagcgttttgatcccaaaggtatttttatacgt
caatggttacctgaactcaaaaatgttcctgaccaatacattcatactccccacaattgg
attgataacaagaatacaattcatccttatcctcatccaatagttgaccacaaacaagct
cgtcaacacactattagcaagtattctatcgcccaaaaacaatcaatagcataa

DBGET integrated database retrieval system