KEGG   Candidatus Liberibacter solanacearum: CKC_04245Help
Entry
CKC_04245         CDS       T01373                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:lso00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(888636..889181)
Genome map
AA seq 181 aa AA seqDB search
MWKPESNINIKINPDDFIAIGIGSNIGDKKKYISHALNLIHQHNNCEIIAVSRLYKTVPW
GNIDQDFFLNAVALVRTKISPDSLLDILLSIENNLKRQRNEKWGARTIDLDILLAGKYSS
STERLTIPHPYIVQRAFVLVPLADVAPHMVIHGFSVIDWIKKIDVSGVQVINEGYYWWCD
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtggaaaccagagtcgaatataaatattaagatcaatcctgatgattttattgctatt
ggaataggtagcaatattggagataaaaaaaaatatatttctcatgcattaaatctcatt
catcaacataacaattgtgagatcattgctgtatcacgtttatataagaccgttccttgg
ggaaacatagatcaggatttctttttaaacgccgtagcactcgtcagaacaaaaatatcc
cccgattctttattggatattcttctttcgattgaaaataatttaaaaagacagagaaat
gaaaaatggggcgcgcgcacaattgatcttgatatcctcttggcagggaaatattcttct
tccacagaacgtttaacaataccgcatccatatattgtccaaagagcttttgtccttgtt
ccattagcagatgttgctcctcatatggtaatacatggtttttctgtaatagattggatt
aaaaaaatcgatgttagtggagtgcaagttatcaatgagggatactattggtggtgtgat
ttataa

DBGET integrated database retrieval system