KEGG   Candidatus Liberibacter solanacearum: CKC_04380Help
Entry
CKC_04380         CDS       T01373                                 

Definition
triosephosphate isomerase protein
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKC_04380
   01230 Biosynthesis of amino acids
    CKC_04380
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKC_04380
   00051 Fructose and mannose metabolism
    CKC_04380
   00562 Inositol phosphate metabolism
    CKC_04380
Enzymes [BR:lso01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CKC_04380
Exosome [BR:lso04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CKC_04380
  Exosomal proteins of bladder cancer cells
   CKC_04380
  Exosomal proteins of melanoma cells
   CKC_04380
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(919691..920470)
Genome map
AA seq 259 aa AA seqDB search
MRSGIRPIVVGNWKMHGLRASLDKIEKIVESVEKNHCRIDVAICPPATLTYLASRLCEKS
SVMIGAQDCHIDEYGSYTGDISANMLADCGARFVILGHSERRIGHQESSQVVQCKVKYAY
NAGISPIICIGETDEEYRSGRTLEVLQKQLDFSLPHECGDSIPIVAYEPIWAIGTGDVPS
VIELEKIHSFMHHVLVDRFPAKGEKIRILYGGSVSASNVKDFLCIENIDGLLVGGASLQY
ESFLTIIETFEQSYVDSFL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagatcaggcattcgtccaattgtagtcgggaactggaaaatgcatgggttacgtgca
tctcttgacaaaattgagaaaattgttgaaagcgtagagaaaaatcattgtcgtattgat
gttgctatatgtcctccagcaacccttacgtatttagcatcgcgtctttgtgaaaaatct
tcagtaatgattggtgcacaagattgccatatagatgaatatggctcttatactggcgat
atttcggcaaatatgttggctgattgtggggctcgttttgtaattttagggcattctgaa
cgacgtatcggacatcaagaaagcagtcaagttgttcaatgtaaagtgaaatatgcttat
aatgcagggatctctccaataatatgtatcggagaaacggatgaggagtatcgttctgga
agaactcttgaagttttgcaaaagcaattagattttagcttgcctcatgagtgtggagat
tcgattcctattgttgcttatgaacccatatgggccattggtacaggagatgttccttct
gttatagagcttgaaaaaattcattcttttatgcatcatgttttagtggatcgtttccct
gcaaagggagaaaaaatacgtattctatatggaggatcagtaagtgcttctaatgtaaaa
gattttctgtgtattgaaaatatagatggattattagtcggaggcgctagtcttcaatat
gaatcattcttgacaattattgaaacttttgagcaatcatacgttgattcttttctttaa

DBGET integrated database retrieval system