KEGG   Candidatus Liberibacter solanacearum: CKC_04555Help
Entry
CKC_04555         CDS       T01373                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lso00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(962435..963109)
Genome map
AA seq 224 aa AA seqDB search
MNRYHLSPMTVDHRGIMLIISSPSGVGKSTIARHILKSDHNFEMSISVTTRSRRPDEVDG
EDYHFLTLNKFEELQKAHAFIEWAEVHGNFYGTLRDPIERAISQGRDMLFDIDWQGAHHL
RKHMKSDIVSFFILPPTMHELRSRLIMRATKNQEEKEMVQLRLKNAYLEIKQWNYYDYVI
VNDDLEDSLGMVKSVIGVERMRRNRLINSISGFVGRLLEEEVMY
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgatatcatctctcgcctatgactgttgatcatcgaggaattatgttgattatt
tcttccccttctggggttggaaaatctactatagcgcgtcatattctcaaatctgatcat
aattttgagatgtcaataagtgtaacaacgcgtagtcgtcgtccagatgaagttgatggg
gaggattaccactttttaacgcttaataagtttgaagaattgcaaaaggctcatgccttt
atagaatgggcagaagtacatggcaatttttatggtactttacgtgatcctatagagagg
gctatatctcaaggaagggatatgctttttgatattgattggcaaggagcgcatcatctt
cggaaacatatgaaatcagatattgtttcgttctttatcttgccgccgacaatgcatgaa
ttgcgttctcgtttgattatgcgtgccacaaagaatcaggaagaaaaggaaatggttcaa
ttgcgattgaagaatgcttatttggaaatcaaacaatggaattattatgattatgtcatt
gtcaatgatgatttagaagattctttagggatggtaaaatctgttattggcgttgaaaga
atgcgacgtaatcgtttgataaatagtatcagtggttttgtcggaagattattagaagaa
gaagttatgtattga

DBGET integrated database retrieval system