KEGG   Candidatus Liberibacter solanacearum: CKC_05480Help
Entry
CKC_05480         CDS       T01373                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lso  Candidatus Liberibacter solanacearum
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:lso00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CKC_05480 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CKC_05480 (glk)
   00052 Galactose metabolism
    CKC_05480 (glk)
   00500 Starch and sucrose metabolism
    CKC_05480 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    CKC_05480 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CKC_05480 (glk)
   00524 Butirosin and neomycin biosynthesis
    CKC_05480 (glk)
Enzymes [BR:lso01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CKC_05480 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1168679..1169770)
Genome map
AA seq 363 aa AA seqDB search
MRGYFLFSTQHFFSVFFNMNMSNRNFPTAFPVLLADIGGTNVRFAILRDMESEIECCGTV
KTADYESLEHAIQEVILSKISIRLRSAFLALATSIGDQKKFMLTNYQWIIDPEALISQMN
FEDVLLINDFEAQALAVCFLSDSHYVSVGPDIKRNNCSFSSRVIVGPGTGLGVSGVIRLK
NSWIPISGEGGHMNIGPSSKRDFEIFPYLIENERLSAEMLLSGRGLVNIYKAICKADGFE
NETSLSAQDIVCQEAHPIALEAINLFCDYLGRIAGDLALIFMSRGGVYISGGIPNKIIHL
LRNSSFRASFENKAPHKELMRKIPTYVITNPYIAISGMLSYIKMTDNFNLITDEGIRSRW
IKP
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttgaggggatattttttattctcaacacaacattttttcagtgtgttttttaatatgaat
atgtcgaatagaaattttcctactgcttttcctgttcttctagctgacataggaggaaca
aatgttcgttttgcgatattgcgagatatggaatctgagattgagtgttgtgggacagta
aaaactgcggattacgagagtttagaacatgcaatacaagaggtcattcttagcaagatt
tccatacgattacgttctgcttttttagctcttgctacgtcgattggtgatcaaaaaaaa
tttatgcttactaattatcaatggattattgatccagaagcattgatttctcaaatgaat
tttgaagatgttttgttgattaatgatttcgaagcgcaggcattggctgtttgtttttta
tctgattctcattatgtttctgtgggtcctgatataaaaagaaataattgttctttttcg
tcacgagttattgttggtcctggcacaggattgggagtttcgggtgtaatacgattaaaa
aattcgtggattccaatttctggagaaggaggacatatgaatataggtcctagttcgaaa
cgtgattttgagattttcccttatttaatagagaatgaacgactttctgccgaaatgttg
ctttctggtagggggcttgttaatatttataaagcgatttgtaaggccgatggttttgaa
aatgaaacatcattatctgcacaagatattgtttgccaggaagcacaccccattgcgctt
gaagcaatcaatcttttttgtgattatcttgggcgtattgcaggtgatcttgctttgatt
tttatgtcgaggggcggggtgtatatttctggaggtattccgaataaaattatacattta
ttgcgtaattctagttttcgggcttcttttgaaaataaagcgcctcataaagaacttatg
cgtaaaatacctacatacgttataacaaacccttatattgcgatttcaggtatgctttct
tatatcaaaatgacagataactttaatcttatcaccgatgaaggcataaggagtcgttgg
ataaagccttaa

DBGET integrated database retrieval system