KEGG   Lysinibacillus sphaericus: Bsph_0031Help
Entry
Bsph_0031         CDS       T00656                                 

Definition
hypothetical protein
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Bsph_0031
   00240 Pyrimidine metabolism
    Bsph_0031
Enzymes [BR:lsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     Bsph_0031
    2.7.1.76  2'-deoxyadenosine kinase
     Bsph_0031
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
38323..38991
Genome map
AA seq 222 aa AA seqDB search
MNLREKYDIPPQTVITIAGTVGVGKSTMTKALAEALNFRTSFEKVDTNPYLDKFYEDFEK
WSFHLQVYFLAERFKEQKRIFEYGGGFIQDRSIYEDTGIFAKMHYDKGTMSPTDYETYTN
LFDAMVMTPYFPHPDLLVYLEGPIDAVIGRIQERGRAMEQQTPNDYWIEMHERYENWINN
FNSCPVLRLDINDYDLLKNPDAIESIVSRIGHMLKQTSHLRK
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaagagagaaatacgatattcctccacaaaccgtcatcacgattgccggtact
gtaggcgtaggaaagtccacgatgacaaaagctttagcagaagcactgaatttccgtaca
tccttcgaaaaagtagataccaatccatatcttgataaattttatgaggattttgaaaag
tggagcttccatttacaagtttattttttagcagagcgttttaaggaacagaaacgtatt
tttgagtatggtggagggtttatacaagaccgctctatttatgaagatactgggattttc
gcaaaaatgcattatgataagggaacaatgagcccaacagattatgaaacgtacacgaat
ttgtttgatgctatggtaatgacaccgtatttcccacatcccgatttacttgtttatctt
gaaggaccgattgatgctgttattgggcgaatacaagaacgtgggcgcgcaatggagcaa
caaacgccaaatgattattggatagaaatgcatgaacgttatgaaaactggattaataat
tttaattcctgtccagttctacgtttagatattaatgattatgatttattaaaaaatcct
gatgcaattgaatcaattgtgagccgtatcggtcatatgctaaaacaaacaagccattta
agaaaatag

DBGET integrated database retrieval system