KEGG   Lysinibacillus sphaericus: Bsph_0040Help
Entry
Bsph_0040         CDS       T00656                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
lsp  Lysinibacillus sphaericus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bsph_0040 (recR)
DNA repair and recombination proteins [BR:lsp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Bsph_0040 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
47823..48377
Genome map
AA seq 184 aa AA seqDB search
MKLPGIGPKTAARLAFFVLSMKEEDVLSFSKALIDAKRNLSYCSVCGNITDVDPCHICTD
KQRDHSIICVVQDTKDVIAMEKMRDYNGMYHVLQGAISPMDGIGPEDINVASLLVRLHDE
SVQELILATNSTIEGEATAMYISRLVKPSGIRTTRIAHGLPVGGDLEYADEVTLSKAMEG
RREL
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgccaggtatcgggccgaaaactgcggctcgtctggcgttttttgtgttatca
atgaaggaagaagatgtcttatctttttctaaagcattaattgatgctaaacggaattta
agctattgttccgtgtgtggcaatattacagatgtagacccgtgtcacatatgtacagat
aaacaacgagatcattctattatttgtgttgttcaagacacaaaagatgtaattgcgatg
gaaaaaatgcgtgactataatggtatgtaccatgtactacagggtgcgatatcaccaatg
gatggcattggcccagaggatatcaatgtagcttccctgttagtccggttgcacgatgaa
agtgtccaagagcttattctagctacgaattcaactattgaaggcgaggcaacagctatg
tatatatctcgccttgtcaaaccgtcaggtattcgtacgacccgcatagcgcatgggtta
ccagtaggcggggacttagaatatgcagatgaggtaacgttatcgaaggcaatggaaggt
cgacgtgagttgtga

DBGET integrated database retrieval system