KEGG   Lysinibacillus sphaericus: Bsph_0065Help
Entry
Bsph_0065         CDS       T00656                                 

Definition
(GenBank) 4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00900  Terpenoid backbone biosynthesis
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bsph_0065
Enzymes [BR:lsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Bsph_0065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: ACA37703
UniProt: B1HS85
Position
70466..71392
Genome map
AA seq 308 aa AA seqDB search
MNKLVRKGIVYMCSYKGGRKMLYVKAPAKINLTLDVLYKRPDNFHEVEMVMTTVDLADRI
SLESREDGVIQIISTDNFVPNDHRNFAYQAARLIKDTYGIKQGVSITIEKEIPIAAGLAG
GSSDAAATLKGLNELWNLGLSIDELAELGAKIGSDVSFCVYGGTALATGRGEKIKEIPAP
PNCWVVLAKPKIGVSTAEVYGGLKVEGLEHPNTKQMIQAIETKDYELLCSSLGNVLETVT
FKLHPEVIMLKEQMKRFGADATLMSGSGPTVFGLVDSEARVSRIYNGLRGFCEEVYAVRI
LGERNTLA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgaataaacttgtgcgaaaaggaattgtttatatgtgtagctataagggaggaagaaag
atgctttatgtaaaggcgcctgcaaaaattaatttaacattagatgtactttataaaaga
ccagataattttcacgaagttgagatggttatgacaactgtcgatttagctgatcgtatc
agtcttgaatctcgagaagatggtgtaatccaaataatttcaacggataattttgtaccg
aatgatcatcgtaattttgcttaccaggcagcgcgtctcattaaagatacatatggcatt
aaacaaggtgtatccattactattgaaaaagaaatcccaatcgctgctgggcttgccggt
ggtagtagtgatgcagctgctacactaaagggtcttaatgaactttggaatttagggtta
tcgatagatgaattggctgaactaggtgctaaaatcggttcagatgtatcattttgtgtc
tatggtggcacggcacttgccacaggacgtggagaaaaaataaaggaaattcctgcgcct
cctaactgctgggtagtattagcaaaacctaaaatcggtgtatccactgctgaagtatat
ggaggtcttaaggttgaaggactggaacatcctaatacgaagcaaatgatacaggctatt
gaaacgaaggattatgagctgttatgttcatcgttagggaatgttttggaaactgtaaca
tttaagctacatccagaagtcatcatgttaaaggaacaaatgaaacgctttggagcagat
gctacattaatgagcggaagcggtcctactgtatttgggctagtggatagtgaggctcgt
gtcagtcgtatttataatggtttacgtggtttttgtgaagaagtttatgcagtaagaata
ttgggagagcgaaatacgcttgcctag

DBGET integrated database retrieval system