KEGG   Lysinibacillus sphaericus: Bsph_0333Help
Entry
Bsph_0333         CDS       T00656                                 

Definition
peroxiredoxin bcp
Orthology
K03564  
peroxiredoxin Q/BCP [EC:1.11.1.15]
Organism
lsp  Lysinibacillus sphaericus
Brite
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     Bsph_0333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
354017..354493
Genome map
AA seq 158 aa AA seqDB search
MTLQEGQKVPDFSLMNEKGETVQLTDFKGQNVILYFYPKDMTPGCTTEACDFRDRFEDFS
HLNAVVLGVSPDDANKHTKFIDKHGLPFSLLVDEDHAVAEAYGVWVLKKMYGREFMGIER
STFLIDSEGKLMKAWRKVRVKNHIEEVYAYLAEQEATT
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcaagaaggacagaaggtacccgatttttctcttatgaatgaaaagggagag
acggtacagctaactgattttaaaggacagaatgtaattttatacttttacccaaaagat
atgacaccaggttgcacaactgaagcatgtgattttcgagataggtttgaggactttagt
catttaaacgctgttgttctaggcgttagtccagatgatgcaaacaaacatacaaaattt
attgataagcatggcttgcctttttctttattagtagatgaagatcatgctgtagcggag
gcgtatggtgtatgggtcttaaagaaaatgtatggacgtgaatttatggggattgagcgt
tccacatttttaattgattcggagggtaagttaatgaaagcttggcgtaaagtacgtgtg
aaaaatcatattgaagaagtttatgcctatttagcagaacaggaggcgacaacatga

DBGET integrated database retrieval system