KEGG   Lysinibacillus sphaericus: Bsph_0440Help
Entry
Bsph_0440         CDS       T00656                                 

Gene name
hisD
Definition
histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsp01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:lsp00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
459744..461018
Genome map
AA seq 424 aa AA seqDB search
MKITKLAKGISLKRPLEGGNEEQLKVVRQVLTDVRTQGDVALRAYTERWDGYMPTSLRVT
KEEIQEAVNALDQQLYQDLVEAAQNIRLYHEQQSRQGYRLELGDGSWLGQRVTALDAVGL
YVPGGTAAYPSSVLMNVIPAQVAGVKRIVIASPAGLDGKMPAGVLVAAQLLGIEEIYKIG
GAQAIAALAYGTETIAPVDKITGPGNIFVALAKREVFGEVAIDMIAGPSEIAVLADDTAF
PDEIAADLLSQAEHDRLACAVLVTTSEKLAKKVAEEVEKQLEILPRQEVARASIENFGVI
YIAETVSDAVEAINSLAPEHLEIMTNNAEAIAEQIRHAGGIFIGRYSSEPVGDYFAGTNH
VLPTNSTARFASGLNVDDFVKKSSVVYYSEKTWQEHAPKIARLARMEGLEGHARAVESRG
WKKE
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataactaaactagcaaagggtatttccttaaaaagaccacttgaaggtggaaat
gaggaacagttaaaagttgtaagacaggtgttaacagatgtgaggacacagggagacgta
gcgttacgtgcctatacagaacgttgggacgggtatatgcctacaagcttgcgtgtcacg
aaggaggaaatacaagaagctgtaaatgctcttgaccaacaactctatcaggatttggtg
gaagcagctcaaaatattcgactttatcatgaacaacagtcacgacagggttatcgctta
gagctaggtgacggttcttggctaggtcaacgagtaacagctctagatgcagtaggatta
tatgttcctggcggtacagctgcctatccctcatcggtgctaatgaatgtgattccagca
caggtagcaggtgtgaagcgtattgtgattgcttctccagcaggccttgatggaaaaatg
ccagcaggtgtcctagtggcggctcagcttttaggaatcgaagaaatttataaaataggt
ggggcacaagcaattgctgctcttgcttatggcacagagaccatcgcaccagtcgataaa
attacaggcccaggaaatatttttgtagcccttgctaaacgggaggtatttggggaagtt
gccattgatatgattgcgggacctagcgaaattgcagtactagctgatgacactgcattt
ccagacgaaattgctgcagatctgttatctcaagcagaacatgaccgattagcttgtgct
gttctcgtcacgacctcagagaaattggccaaaaaggtagctgaagaagttgaaaagcaa
ttggagattttaccacgtcaagaagtagcgcgtgcttcaatcgaaaattttggggtcatt
tatatagctgaaacggtatcagatgcagtggaagcgattaattcattagcaccggagcat
ttagaaattatgacaaataatgctgaggcgatcgctgaacaaataaggcatgcaggtggt
atttttattggtcgttatagttcagagcctgttggtgactattttgcggggaccaatcat
gtgttaccaactaatagcacagcacgttttgctagtggcttaaacgtagatgattttgtg
aaaaaatcaagtgttgtttattacagtgaaaaaacttggcaagagcatgcaccaaaaatt
gcacgtctcgcacgtatggagggtttagagggccatgcacgtgcagtggaatctcgcgga
tggaagaaggaatag

DBGET integrated database retrieval system