KEGG   Lysinibacillus sphaericus: Bsph_0466Help
Entry
Bsph_0466         CDS       T00656                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_0466
   01230 Biosynthesis of amino acids
    Bsph_0466
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_0466
   00051 Fructose and mannose metabolism
    Bsph_0466
   00562 Inositol phosphate metabolism
    Bsph_0466
Enzymes [BR:lsp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bsph_0466
Exosome [BR:lsp04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bsph_0466
  Exosomal proteins of bladder cancer cells
   Bsph_0466
  Exosomal proteins of melanoma cells
   Bsph_0466
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483815..484576
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPALYLPTLVQVASESELA
IGAQTMHYENEGAFTGEISPAQLASVDVDYVILGHSERREYYNETDEAINKKVAAALAHN
IVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQVEHMVIAYEPIWAIGTGKTATA
DDANQVCGAIRSVVEELFDAATANAVRIQYGGSVKPDNVHELLSKEHIDGALVGGASLQP
ESYLTLLEAAANA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggtaactggaaaatgtttaaaacatttgaagaagctata
caatttgtagatgccgtacaggataaacttccttctaatgagaaagtagacgccgtaatt
tgtgcaccagcactttacctgcctacactggtgcaagttgctagtgaatcagagctagct
attggtgctcaaacgatgcactatgagaatgaaggtgcctttactggtgaaattagtcct
gcacagctagcaagtgtggatgtggattatgttatattaggtcactcagaacgtcgcgaa
tattacaatgaaactgatgaggctattaataaaaaagtagcagcagcacttgcacataat
attgtaccgattatttgctgtggtgaaacgctagaggaacgagaagcgggaacgacagag
caaaaggttgcgggccaaataaaagccgcacttgctggatttgaagcgcagcaagtagag
catatggtcattgcctatgaaccaatttgggcaatcggtacaggtaaaacggctacagca
gatgatgccaatcaagtttgcggagcgattcgttcggtcgttgaggaattatttgatgct
gcaacggccaatgcagttcgcattcaatatggtggcagcgttaaaccagacaacgttcat
gagcttttatcaaaagagcatattgatggagccttagtaggtggagcaagcttacaacca
gaatcttatttaacattattggaggcggcagcaaatgcctaa

  All links  
No link information was found.   
DBGET integrated database retrieval system