KEGG   Lysinibacillus sphaericus: Bsph_0466Help
Entry
Bsph_0466         CDS       T00656                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:lsp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lsp00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:lsp00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:lsp00562]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
483815..484576
Genome map
AA seq 253 aa AA seqDB search
MRKPIIAGNWKMFKTFEEAIQFVDAVQDKLPSNEKVDAVICAPALYLPTLVQVASESELA
IGAQTMHYENEGAFTGEISPAQLASVDVDYVILGHSERREYYNETDEAINKKVAAALAHN
IVPIICCGETLEEREAGTTEQKVAGQIKAALAGFEAQQVEHMVIAYEPIWAIGTGKTATA
DDANQVCGAIRSVVEELFDAATANAVRIQYGGSVKPDNVHELLSKEHIDGALVGGASLQP
ESYLTLLEAAANA
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaaccaattattgcaggtaactggaaaatgtttaaaacatttgaagaagctata
caatttgtagatgccgtacaggataaacttccttctaatgagaaagtagacgccgtaatt
tgtgcaccagcactttacctgcctacactggtgcaagttgctagtgaatcagagctagct
attggtgctcaaacgatgcactatgagaatgaaggtgcctttactggtgaaattagtcct
gcacagctagcaagtgtggatgtggattatgttatattaggtcactcagaacgtcgcgaa
tattacaatgaaactgatgaggctattaataaaaaagtagcagcagcacttgcacataat
attgtaccgattatttgctgtggtgaaacgctagaggaacgagaagcgggaacgacagag
caaaaggttgcgggccaaataaaagccgcacttgctggatttgaagcgcagcaagtagag
catatggtcattgcctatgaaccaatttgggcaatcggtacaggtaaaacggctacagca
gatgatgccaatcaagtttgcggagcgattcgttcggtcgttgaggaattatttgatgct
gcaacggccaatgcagttcgcattcaatatggtggcagcgttaaaccagacaacgttcat
gagcttttatcaaaagagcatattgatggagccttagtaggtggagcaagcttacaacca
gaatcttatttaacattattggaggcggcagcaaatgcctaa

DBGET integrated database retrieval system