KEGG   Lysinibacillus sphaericus: Bsph_0634Help
Entry
Bsph_0634         CDS       T00656                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:lsp01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:lsp00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:lsp00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652003..653616
Genome map
AA seq 537 aa AA seqDB search
MGKQLMKQATTGKLKIVGEQNEQTNEILTPEALEFVLALHEKFDARRKELLNARQKRQKR
LDAGEKLDFLPETKHIREGDWSIAPLPQDLQDRRVEITGPVDRKMVINALNSGAKMFMAC
FEDASSPTWENMIGGQINMRDAINKTIEFTQASNGKTYKLNAETAVLLVRPRGLHLLEKH
VLVQGEPISGSFFDFGLYLFHNAKNALAKGTGPYFYLPKLESHLEARLWNDVFVFAQDYI
GIPQGTIKATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSYIKRLRNQADVILP
DRGQVTMTVPFMKAYTSLCIQTCHKRNAPAMGGMAAQIPVKNDDEANAVAFAKVAEDKRR
EATEGHDGTWVAHPGMVATAMEQFDAIMPTPNQIHKKREDVHVTAEDLVAVPEGTITLEG
LRVNCSVGVQYIASWLRGNGAAPINNLMEDAATAEISRTQVWQWIRHPKGILDDGRGITL
AFVLEILEEELTKIKEAVGEQAYNCGRFDEAAELFKSLIAQDEFAEFLTLPGYEKLA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaacaactaatgaaacaagcaacgacaggtaagcttaaaattgttggagaacaa
aatgagcaaacaaatgaaattttaacacctgaagctcttgagtttgttcttgccctgcac
gagaaatttgatgctcgccgtaaagagttattgaatgctcggcagaaacgccaaaagcgt
ctagatgcgggagagaaactagatttcttacctgaaacaaagcatattcgtgaaggagat
tggtcaattgcacctcttccacaagatttgcaggatcggcgtgttgaaattacagggccg
gttgaccgtaaaatggttattaatgctttaaactctggagcaaagatgtttatggcttgc
tttgaggatgcttcttctccaacatgggaaaatatgattggtggtcaaattaatatgcgt
gatgctattaataagacgattgaatttacacaagcatccaatggtaaaacgtataagcta
aatgctgaaacagccgtgttactagttcgtcctcgaggcttacatctgcttgaaaagcac
gtacttgttcaaggtgaaccgatttccggaagtttcttcgactttggtttgtatctattc
cataatgctaaaaatgcactggcaaaaggtacaggaccttatttctatctaccgaagctt
gaaagccatttagaagctcgactatggaacgatgtctttgtatttgcgcaagattatatt
ggcattccacaaggtactataaaagcaactgtattaatcgaaactatattagcggcattt
gaaatggatgagattttatatgagctacgtgaacattcggctggcctgaattgtggacgt
tgggactatattttcagttacattaaacgccttcgtaatcaagctgatgtcattttacca
gaccgaggtcaagttacaatgaccgttccattcatgaaggcttatacatctttatgtatt
caaacttgtcataagcgtaatgcaccagcaatgggtggaatggctgcacaaattccggtt
aaaaatgatgatgaggcgaatgcagtggcatttgcaaaggttgctgaagataagcgacgt
gaagcaacagaaggtcatgatggtacttgggtagcacatccaggtatggtggcaacagca
atggagcaatttgatgccattatgccgacacctaaccaaattcataaaaagcgagaggat
gtacacgttactgcggaagatttagtagctgtaccagagggcacgattacccttgaaggg
cttcgtgttaactgtagtgttggtgtacaatatattgcttcatggcttcgtggtaatggt
gctgcacccattaacaatttaatggaggatgctgcaacagcagaaatttctcgtacacaa
gtgtggcaatggattcgacatcccaaaggtattttagatgatggacgcggtattacttta
gcgtttgtccttgaaattctggaagaagagcttacgaaaattaaagaggctgttggggaa
caagcctataactgcggtcgctttgacgaagctgctgaactgtttaaatctttaattgcg
caagatgaattcgcggaattcttgacacttccaggctatgaaaaattagcgtaa

DBGET integrated database retrieval system