KEGG   Lysinibacillus sphaericus: Bsph_0634Help
Entry
Bsph_0634         CDS       T00656                                 

Definition
(RefSeq) malate synthase
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_0634
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bsph_0634
   00630 Glyoxylate and dicarboxylate metabolism
    Bsph_0634
Enzymes [BR:lsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Bsph_0634
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
652003..653616
Genome map
AA seq 537 aa AA seqDB search
MGKQLMKQATTGKLKIVGEQNEQTNEILTPEALEFVLALHEKFDARRKELLNARQKRQKR
LDAGEKLDFLPETKHIREGDWSIAPLPQDLQDRRVEITGPVDRKMVINALNSGAKMFMAC
FEDASSPTWENMIGGQINMRDAINKTIEFTQASNGKTYKLNAETAVLLVRPRGLHLLEKH
VLVQGEPISGSFFDFGLYLFHNAKNALAKGTGPYFYLPKLESHLEARLWNDVFVFAQDYI
GIPQGTIKATVLIETILAAFEMDEILYELREHSAGLNCGRWDYIFSYIKRLRNQADVILP
DRGQVTMTVPFMKAYTSLCIQTCHKRNAPAMGGMAAQIPVKNDDEANAVAFAKVAEDKRR
EATEGHDGTWVAHPGMVATAMEQFDAIMPTPNQIHKKREDVHVTAEDLVAVPEGTITLEG
LRVNCSVGVQYIASWLRGNGAAPINNLMEDAATAEISRTQVWQWIRHPKGILDDGRGITL
AFVLEILEEELTKIKEAVGEQAYNCGRFDEAAELFKSLIAQDEFAEFLTLPGYEKLA
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
gtgggtaaacaactaatgaaacaagcaacgacaggtaagcttaaaattgttggagaacaa
aatgagcaaacaaatgaaattttaacacctgaagctcttgagtttgttcttgccctgcac
gagaaatttgatgctcgccgtaaagagttattgaatgctcggcagaaacgccaaaagcgt
ctagatgcgggagagaaactagatttcttacctgaaacaaagcatattcgtgaaggagat
tggtcaattgcacctcttccacaagatttgcaggatcggcgtgttgaaattacagggccg
gttgaccgtaaaatggttattaatgctttaaactctggagcaaagatgtttatggcttgc
tttgaggatgcttcttctccaacatgggaaaatatgattggtggtcaaattaatatgcgt
gatgctattaataagacgattgaatttacacaagcatccaatggtaaaacgtataagcta
aatgctgaaacagccgtgttactagttcgtcctcgaggcttacatctgcttgaaaagcac
gtacttgttcaaggtgaaccgatttccggaagtttcttcgactttggtttgtatctattc
cataatgctaaaaatgcactggcaaaaggtacaggaccttatttctatctaccgaagctt
gaaagccatttagaagctcgactatggaacgatgtctttgtatttgcgcaagattatatt
ggcattccacaaggtactataaaagcaactgtattaatcgaaactatattagcggcattt
gaaatggatgagattttatatgagctacgtgaacattcggctggcctgaattgtggacgt
tgggactatattttcagttacattaaacgccttcgtaatcaagctgatgtcattttacca
gaccgaggtcaagttacaatgaccgttccattcatgaaggcttatacatctttatgtatt
caaacttgtcataagcgtaatgcaccagcaatgggtggaatggctgcacaaattccggtt
aaaaatgatgatgaggcgaatgcagtggcatttgcaaaggttgctgaagataagcgacgt
gaagcaacagaaggtcatgatggtacttgggtagcacatccaggtatggtggcaacagca
atggagcaatttgatgccattatgccgacacctaaccaaattcataaaaagcgagaggat
gtacacgttactgcggaagatttagtagctgtaccagagggcacgattacccttgaaggg
cttcgtgttaactgtagtgttggtgtacaatatattgcttcatggcttcgtggtaatggt
gctgcacccattaacaatttaatggaggatgctgcaacagcagaaatttctcgtacacaa
gtgtggcaatggattcgacatcccaaaggtattttagatgatggacgcggtattacttta
gcgtttgtccttgaaattctggaagaagagcttacgaaaattaaagaggctgttggggaa
caagcctataactgcggtcgctttgacgaagctgctgaactgtttaaatctttaattgcg
caagatgaattcgcggaattcttgacacttccaggctatgaaaaattagcgtaa

DBGET integrated database retrieval system