KEGG   Lysinibacillus sphaericus: Bsph_0685Help
Entry
Bsph_0685         CDS       T00656                                 

Definition
glutathione peroxidase bsaA-like protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:lsp00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:lsp00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702773..703225
Genome map
AA seq 150 aa AA seqDB search
MTLEDGTDYSLERYKGKPMLIVNTASKCGFTPQFEELEGLFEKYQDEGLVVLGFPSNQFK
QELATAEEAASQCRLEYGVTFPMHKIVKVNGKEAHPIFDYLTSHSKGFLGNSIKWNFTKF
LVNRDGEVVGRYASADKPSSFEDDIKKVLA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtgactttagaagatggtactgactatagcctagagcgatataaagggaagccaatgtta
attgtcaatactgcttcaaaatgtggctttacaccacaattcgaagaattagaaggtctc
tttgaaaaatatcaggatgaaggtcttgttgtactaggtttcccgtccaatcaattcaag
caagagctggccactgctgaagaagctgcttcacaatgtcggctggaatatggggtaacc
ttcccgatgcataaaatcgttaaggtgaatggtaaggaagcgcatccgatttttgattat
ctcacttctcattctaaagggtttttaggcaacagcattaaatggaatttcaccaaattc
ttagtgaatcgagatggcgaggttgttggacgctacgcatcggcagataaaccaagtagt
tttgaagatgatattaaaaaagttttagcataa

DBGET integrated database retrieval system