KEGG   Lysinibacillus sphaericus: Bsph_0685Help
Entry
Bsph_0685         CDS       T00656                                 

Definition
glutathione peroxidase bsaA-like protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Bsph_0685
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Bsph_0685
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Bsph_0685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
702773..703225
Genome map
AA seq 150 aa AA seqDB search
MTLEDGTDYSLERYKGKPMLIVNTASKCGFTPQFEELEGLFEKYQDEGLVVLGFPSNQFK
QELATAEEAASQCRLEYGVTFPMHKIVKVNGKEAHPIFDYLTSHSKGFLGNSIKWNFTKF
LVNRDGEVVGRYASADKPSSFEDDIKKVLA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
gtgactttagaagatggtactgactatagcctagagcgatataaagggaagccaatgtta
attgtcaatactgcttcaaaatgtggctttacaccacaattcgaagaattagaaggtctc
tttgaaaaatatcaggatgaaggtcttgttgtactaggtttcccgtccaatcaattcaag
caagagctggccactgctgaagaagctgcttcacaatgtcggctggaatatggggtaacc
ttcccgatgcataaaatcgttaaggtgaatggtaaggaagcgcatccgatttttgattat
ctcacttctcattctaaagggtttttaggcaacagcattaaatggaatttcaccaaattc
ttagtgaatcgagatggcgaggttgttggacgctacgcatcggcagataaaccaagtagt
tttgaagatgatattaaaaaagttttagcataa

DBGET integrated database retrieval system