KEGG   Lysinibacillus sphaericus: Bsph_1259Help
Entry
Bsph_1259         CDS       T00656                                 

Gene name
glcK
Definition
6-phosphate glucose kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_1259 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_1259 (glcK)
   00052 Galactose metabolism
    Bsph_1259 (glcK)
   00500 Starch and sucrose metabolism
    Bsph_1259 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    Bsph_1259 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bsph_1259 (glcK)
   00524 Butirosin and neomycin biosynthesis
    Bsph_1259 (glcK)
Enzymes [BR:lsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bsph_1259 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1344840..1345748
Genome map
AA seq 302 aa AA seqDB search
MNPVWKTGDEKMSHILVADVGGTKLATALFNQHQQLLIKREVPSDISTRDALFHCLINSF
ELLCMEKKLSFKDISKVSIGLPGIVDVQKGLAIYQNNIPWRNFPICERLVEFFPHAQIMM
DNDVHMAAWGEYNARGFQKETMVYVTLSTGISCCTIVNGEFLRGTGLAGEIGFNIVGHAG
ETLEESVAGPAIEKLGRVLLGNSAIRLKDMMELYYKGDPIMEKVLQQIIDCMEKQLHQMI
LMLDPHCIVLGGGFFNHQPKIIEQIKEVIQQRLLRTPFEGKEQIIESSIRKAEAGLYGAA
MK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcctgtgtggaaaactggtgatgaaaagatgagtcatattttagtagccgatgtt
ggtgggacaaagttagccacagctttattcaaccaacaccagcagctcttaattaaaaga
gaggtaccaagtgatatttcaactagagacgctttattccattgtttaatcaacagcttt
gagttgctctgtatggagaagaagctctcttttaaagatatctctaaggtaagcattggt
ttacctggtattgttgatgttcaaaaaggtctagccatctatcaaaataatataccgtgg
cgtaactttccgatttgtgaacgcttagttgaattttttccccatgcacagattatgatg
gataacgatgtgcatatggcagcctggggagagtataatgctagaggatttcagaaggaa
acgatggtatatgtaacattaagtacagggatatcttgttgtaccatcgttaatggtgaa
tttttacgaggaacaggattagctggtgaaatagggtttaatattgtcggtcatgctggt
gaaacgttagaggaaagtgtcgctgggccagctatagaaaagctgggaagagtattacta
ggaaattcagctattcgattaaaagatatgatggagctctattacaagggtgaccctatc
atggagaaggtgttgcagcaaattattgattgcatggaaaaacagttacaccaaatgatt
ttaatgcttgatccacactgcatcgtattaggcggaggtttttttaatcatcagccgaaa
atcatcgagcagattaaagaggtcattcagcaacgtttgttacgtacgccttttgaaggg
aaagagcaaattatagagagtagtattcggaaagctgaggcaggtctgtatggtgcagca
atgaagtaa

DBGET integrated database retrieval system