KEGG   Lysinibacillus sphaericus: Bsph_1280Help
Entry
Bsph_1280         CDS       T00656                                 

Definition
(GenBank) Probable aldehyde dehydrogenase ywdH
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00010  Glycolysis / Gluconeogenesis
lsp00053  Ascorbate and aldarate metabolism
lsp00071  Fatty acid degradation
lsp00280  Valine, leucine and isoleucine degradation
lsp00310  Lysine degradation
lsp00330  Arginine and proline metabolism
lsp00340  Histidine metabolism
lsp00380  Tryptophan metabolism
lsp00410  beta-Alanine metabolism
lsp00561  Glycerolipid metabolism
lsp00620  Pyruvate metabolism
lsp00625  Chloroalkane and chloroalkene degradation
lsp01100  Metabolic pathways
lsp01110  Biosynthesis of secondary metabolites
lsp01120  Microbial metabolism in diverse environments
lsp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_1280
   00053 Ascorbate and aldarate metabolism
    Bsph_1280
   00620 Pyruvate metabolism
    Bsph_1280
  Lipid metabolism
   00071 Fatty acid degradation
    Bsph_1280
   00561 Glycerolipid metabolism
    Bsph_1280
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bsph_1280
   00310 Lysine degradation
    Bsph_1280
   00330 Arginine and proline metabolism
    Bsph_1280
   00340 Histidine metabolism
    Bsph_1280
   00380 Tryptophan metabolism
    Bsph_1280
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bsph_1280
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bsph_1280
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bsph_1280
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bsph_1280
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ACA38888
UniProt: B1HP36
Position
1366840..1368273
Genome map
AA seq 477 aa AA seqDB search
MKKLCMPFLKRGALLMNFTSKDVENMITEQRQFYFSRATKSVKFRKEQLKKLKKSILKYE
KEILNALYLDLRKSEFEAYATEIGIVLDSISYMVKHVEEWMEPEAVKTPIQYQMGKSFIV
REPYGVTLIIGPFNYPFQLVMEPLVGAIVGGNTAIVKPSETSVHTAAIIKKVIEETFHPS
YIRVVEGEKDEVTALIHASFDYIFFTGSVAVGKVVAKAAAERLTPIALELGGKSPAIVDQ
TANLEVAAKRIVWGKFTNTGQTCVAPDYLLVHKDVYDRFMKILKETIRSFYGKNPLKSPD
YGRIVNLRQFDRLQQIIKEERDAITFGGRIDRDDLYIEPTIIEYVKWTSPSMQEELFGPI
LPVMMYNDLPLAIHEIRQLPKPLAAYFFSEHEKATQYFLEELPFGGGCINDTITHVGNLH
LPFGGVGPSGVKAYHGKASFENFTHAKSILKKSSKLETNVLFPPYNQKVKIVRSIMK
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaactatgtatgccatttttgaaaaggggtgctttattgatgaattttacgtct
aaagatgtggaaaatatgataacagagcagcgtcaattttatttttctcgtgccactaaa
agtgtcaaatttcgaaaagagcaattaaaaaaactaaagaaatccattttgaaatatgag
aaggaaatactgaacgcactatacttagacctccggaaaagtgagttcgaagcgtatgca
actgaaattggcattgtcttagatagtatttcttacatggtgaagcatgtggaagaatgg
atggagccagaagcagtcaaaacacctattcaatatcagatgggtaagagctttattgtt
cgtgaaccgtatggtgtaacattaattattggtccgtttaattacccatttcaattggtc
atggaaccattggtaggtgctattgttggcggtaatacagctatcgttaaaccgtcagaa
acatctgtacacactgcagccattataaaaaaggtaattgaagaaacttttcacccatcc
tatatacgtgtagtggaaggggaaaaagatgaggttactgccttaatccatgcttccttt
gactatatcttttttacaggaagtgtagcagttggcaaagtggttgctaaggcagcagca
gaacgattaactccaattgctttagaacttggagggaaaagtccagctattgttgatcaa
acagcgaacctagaagtagcagcgaagcggattgtatggggtaaattcacaaatactggg
caaacatgtgtggcaccagattatttacttgttcacaaagatgtttatgatcgctttatg
aaaattttaaaagagacgatacgttctttttatgggaagaacccattaaaaagccctgat
tacggacgcatcgtgaatcttagacagtttgatcgtttacagcaaattattaaggaagaa
cgtgacgctataacattcggtggacggatagatcgagatgatttatatattgagccaaca
atcatcgaatatgtaaagtggacaagtccttcgatgcaggaagagctttttggccctatc
ctacctgttatgatgtataacgatttaccactggcaattcatgaaatacgccaattaccg
aaaccattagcggcatatttcttctcagagcatgaaaaagcgactcaatactttttagag
gaattgccattcggcggaggatgtattaatgatacgattacacatgttggtaacttacac
ttaccatttggaggtgttggtccatcgggtgtgaaagcatatcatggtaaagcaagcttt
gaaaactttacacatgcaaaatccattttaaagaaatcttctaagcttgagacgaatgta
ctgtttccaccgtataatcaaaaggtgaaaattgtacgctctattatgaaatag

DBGET integrated database retrieval system