KEGG   Lysinibacillus sphaericus: Bsph_1365Help
Entry
Bsph_1365         CDS       T00656                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_1365
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bsph_1365
   00020 Citrate cycle (TCA cycle)
    Bsph_1365
   00620 Pyruvate metabolism
    Bsph_1365
Enzymes [BR:lsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bsph_1365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1460936..1462270
Genome map
AA seq 444 aa AA seqDB search
MAFEFRLPDIGEGIHEGEIVKWFVKAGDTVKEDDILCEVQNDKAVVEIPSPVEGTVEEVL
VGEGTVAVVGDVLIRLDAPGYEDLKLKGDSHAEEKTEAQVQATAESGQNVEKAPAKEEKA
PEKAPEKAETVVDETKRVIAMPSVRKFARDNDVNIREVKGSGKNGRILKEDITNFLNGGG
TVETESATDVTVEEAVQQETTPTAPVVLEGEFPETREKMSGIRKAIAKAMVHSKQTAPHV
TLMDEVDVTALVAHRKKFKDIAAEKGVKLTYLPYVVKALISTLREFPEFNRSLDDATQEI
IQKHYYNIGIAADTDKGLLVPVIKHADRKSVFAVSNEINELATKAREGKLAPHEMKGASM
SITNIGSAGGQWFTPVINHPEVAILGIGRISEKPVIKNGEIVAAPVLALSLSFDHRMIDG
ATAQNALNHLKRLLSEPELLLMEA
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggcatttgaattcagattaccggatattggcgagggaattcacgaaggcgaaatcgtg
aaatggttcgtcaaggctggagatacagtaaaagaagacgatattctttgtgaagtacaa
aatgataaagcagtagtagaaattccttcaccagttgaaggaacagtagaggaagtttta
gtaggagaaggaacagttgccgttgtaggcgatgttttaatccgtttggatgcacctggc
tatgaagatttaaagctaaaaggtgatagtcatgctgaagagaaaacagaagcacaagtt
caagcaactgctgaatctggtcagaacgtagagaaagctcctgctaaagaggagaaagca
ccagagaaagctcctgaaaaagccgagacagttgttgatgaaacaaaacgtgttattgcg
atgccttctgttcgcaaatttgcacgtgataacgacgtaaacatccgtgaggtaaaaggt
tcaggcaaaaatggtcgtattttgaaagaggatattacaaacttcttaaatggtggaggt
actgttgagacagaatcagcaactgatgtgacagttgaagaagctgttcaacaagaaact
actccaacagcaccagttgttcttgaaggggaattcccagaaactcgtgagaaaatgtct
ggtattcgaaaagcgattgcaaaagcaatggtacactcgaaacaaacagctccacatgtt
acactaatggatgaagtcgatgtaacagctcttgtagcgcatcgtaaaaaattcaaagat
atcgcagctgaaaaaggtgttaaattaacatacttaccttatgtagtgaaagcactaatc
tcaacattacgcgaattcccagaatttaatcgctcattagatgatgcaacacaagaaatt
atccaaaagcattactacaatattggtattgcagcggatactgataaaggtttacttgtc
ccagtaatcaagcatgcagatcgcaagtctgtatttgcagtgtcaaatgaaattaatgag
ttagcgactaaagcccgtgaaggtaaacttgcaccacatgaaatgaaaggtgcatctatg
tctattacgaatattggctctgcgggaggtcaatggtttacaccagtaattaatcatcct
gaagtagcaattctaggtattggtcgaatttcagaaaaacctgtaataaaaaatggtgaa
attgtagccgcacctgtgttagcattatcattgagctttgatcatcgtatgatcgatgga
gccactgcgcaaaatgctttaaatcacttgaagcgtttgttaagtgagccagaattatta
ttaatggaggcgtaa

DBGET integrated database retrieval system