KEGG   Lysinibacillus sphaericus: Bsph_1461Help
Entry
Bsph_1461         CDS       T00656                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Bsph_1461
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bsph_1461
Enzymes [BR:lsp01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Bsph_1461
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1549411..1550292
Genome map
AA seq 293 aa AA seqDB search
MMKNLLSMEHLTTEEIHHILDLAQAFENGETSSLSRTYNVANLFFEPSTRTKSSFEMAEH
KIGCHIIPFDAGFSSVTKGETMYDTVKTLEMIGLDAVIIRASEDEYYNELLNGINVAIIN
AGDGAGQHPSQSLLDLYTIKKEFGYFEGLNITIVGDISHSRVAKSNAHALQRLGAKVHFL
CPEEWAGGFEAHHSWDDLIEISDVIMLLRVQHERHKVNKSFSKEGYHQEYGLTIEREKLM
KESAIIMHPAPVNRDVEIASELVECGRSRIFEQVRNGVYTRMAIVETILKGRE
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgatgaagaacttattatcgatggaacatttaacaacagaagagattcaccacatccta
gatcttgcgcaagcttttgaaaatggtgaaacatcatcgttatctcggacatacaacgtt
gccaacttattttttgaaccaagtacacggacaaaatcaagcttcgaaatggctgagcat
aaaattggctgtcatatcattcctttcgatgcgggattttcgagtgttactaaaggggag
accatgtacgatacggtcaaaactttagaaatgataggtttagatgcagtcattattcga
gcatcagaggatgaatattataatgagctactaaatggtattaatgtagcaatcatcaat
gcaggggacggtgcaggacagcatccatcccaatcattattggatctatatacaataaaa
aaagagtttgggtattttgaagggctcaatattacgatagttggagatatctcacatagt
cgagtagcaaaatcaaacgcccatgcattgcaacgtttaggggcaaaagtgcacttcctt
tgtccagaagaatgggcaggaggatttgaagcgcatcattcttgggatgatctaatcgaa
attagcgatgtcattatgctattacgtgtgcaacatgaacgtcataaagtaaataaaagc
ttttcgaaagaaggctaccatcaagaatacggcttaacaatagaacgagaaaagctaatg
aaagaatcagctattattatgcatccagcaccagtgaatcgtgatgtagaaattgcttct
gagcttgtagagtgtggacgctctcgaattttcgagcaggtgcgaaatggagtctataca
cggatggcaattgtggaaacaattttaaaggggagagaataa

DBGET integrated database retrieval system