KEGG   Lysinibacillus sphaericus: Bsph_1484Help
Entry
Bsph_1484         CDS       T00656                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:lsp00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1577696..1578313
Genome map
AA seq 205 aa AA seqDB search
MIKERGLLIVLSGPSGVGKGTVRKELFSQPNTNYEYSISMTTRNPREGEIDGVDYFFKKR
EDFETLIEQGGLLEHAEFVGNYYGTPLAYVNETLDAGRDVFLEIEVQGAAQIRKKAPDAL
FIFLAPPSLTELKDRLVGRGTETEDIIAKRIATASEELEMMSLYDYVVENDEVTNACDRI
NAIIKAEHCRRERVEKRYLSMLRGE
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgataaaagaacgtggattattaattgttctgtctggcccatctggtgtaggtaaaggg
acagtgcgaaaagaattattttctcagccgaatacgaattatgagtattccatctcgatg
acgacacgaaatcctcgcgaaggagaaatcgatggtgtagactattttttcaagaaacga
gaagactttgaaacgttaattgaacagggtggcttattagagcatgctgaatttgtagga
aactactatggtacaccattagcctacgtgaatgaaacactggatgcaggtcgcgatgtg
tttttagaaatcgaagtgcagggtgcagcgcagattcgtaaaaaagcaccagatgcctta
tttattttcttagcccctccaagtttaactgaattaaaagatcgtttagttggacgtggg
acggaaacagaggatatcatagcaaaacgcattgctacagcaagtgaagagcttgaaatg
atgagcttatatgattatgttgtagagaatgatgaagtgacaaatgcctgtgatcgtatt
aatgcgattattaaagcagagcattgccgtagagaacgtgttgaaaaaagatatttgtca
atgttgagaggagaataa

DBGET integrated database retrieval system