KEGG   Lysinibacillus sphaericus: Bsph_1506Help
Entry
Bsph_1506         CDS       T00656                                 

Definition
L-serine dehydratase subunit beta
Orthology
K01752  
L-serine dehydratase [EC:4.3.1.17]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycine, serine and threonine metabolism
Cysteine and methionine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Biosynthesis of amino acids
Class
Metabolism; Overview; Carbon metabolism [PATH:lsp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsp01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lsp00260]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:lsp00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1600302..1600880
Genome map
AA seq 192 aa AA seqDB search
MKFTSVFDIIGPVMIGPSSSHTAGAARIGRVARDLFGRQPKWAKIHLYGSFAETYRGHGT
DVAIVGGLLNYDTFDDRIKTAFEDAEKAGLEYEFIPETANTEHPNTARLVIGDDEGEMSV
VGISIGGGKIEVSEVNGFKLRLTGGMPAILVVHDDRAGCIANVANCLAMHEVNSWTYGSI
TYRTWFNSFNGY
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttacttcggtttttgatattattggaccagtgatgattgggccttcctcctct
catacggcaggtgcggctcgtatcggacgagttgcaagggatttatttggtagacaacct
aaatgggcgaaaattcatttatatggttcgttcgcagaaacgtatagagggcatgggaca
gatgttgccatcgttgggggcttattgaactacgacacatttgatgatcgtattaaaacg
gcatttgaagatgcagaaaaagcaggattggaatatgaatttattccagaaacagctaat
actgagcatccaaatacggcacgtctagttattggagacgatgaaggtgaaatgtctgtt
gtcgggatttctattggcggcggtaaaatagaagtaagtgaagtaaatggctttaaatta
cgtttaacaggtggcatgccggcgattcttgttgtacatgacgatcgtgctggctgcata
gcaaacgtagccaattgcttagcgatgcacgaggttaatagttggacatatggaagtatc
acgtatagaacgtggtttaacagctttaatggttattga

DBGET integrated database retrieval system