KEGG   Lysinibacillus sphaericus: Bsph_1573Help
Entry
Bsph_1573         CDS       T00656                                 

Definition
chemotaxis response regulator protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Bsph_1573
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Bsph_1573
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Bsph_1573
Two-component system [BR:lsp02022]
 CheA family
  CheA-CheYBV
   Bsph_1573
Bacterial motility proteins [BR:lsp02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Bsph_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1661279..1662430
Genome map
AA seq 383 aa AA seqDB search
MDFLHKSKLLVVDDSAFMRKLISDFFVGNSKVEVVGTARNGKDAIKKIQSLKPSVVTMDI
EMPEMNGLDALKEIMIQCPVPVIMLSSTTQLGTENAIAAIESGAVDFVAKPSGTISLDLH
KIQSELVHKVEQAAMVPISKLKKPSGSKRQQDSVTKVSTVNKDLQQHQIPIPVNATASKV
AITKSHTEWNKAGKKIVLIGTSTGGPRALQEVITKIPKSIQAPILIVQHMPAGFTKSLAT
RLDQLSEVVVKEAEQGDILQNGVAYIAPGGYHLKLRKVGTTFGIVLDNQEAPRSGHRPSV
DVMFEDVSQYKDFDKVAVIMTGMGHDGSNGLKALKKTGNVIAIAESAETCIVYGMPKAAV
ETQLVDEVADVDDIALTIMKYLP
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ttggactttttacataaaagcaagctattagttgtggatgattctgcttttatgagaaag
ctaattagtgacttttttgttggcaactcgaaggtggaagtagttggaactgcacgaaat
ggaaaagatgcaatcaaaaagatacaatcattgaagccatcagttgtgacaatggatatt
gagatgcctgaaatgaatgggctagatgcattaaaagaaataatgatacaatgtccagtt
cctgtaatcatgctctctagcaccactcagcttggaacagaaaatgctatagcagctatt
gaaagtggtgctgtagattttgtcgcaaagccaagcggaacaatatctcttgatttacat
aaaatccaaagtgagcttgttcacaaagtagaacaagcagcaatggtgccaatttccaaa
ttgaaaaaaccttctggtagtaaacgacaacaagattcagtaacaaaagtgagtaccgta
aacaaagatttacaacaacatcaaatacctattcctgtgaatgctactgcttctaaagta
gctataactaagtcgcatactgaatggaataaagcggggaaaaagattgtgctaatcggt
acatctacaggaggacctcgtgcgctacaggaggtcattacaaaaattcctaagtctatt
caagctcctatcctcatcgtccagcatatgcctgctggatttacaaaatctctcgctacg
cgtctagatcagctaagtgaagtagttgttaaggaggcggagcaaggagatattttacaa
aatggagtggcttatattgccccaggtggctatcacctaaagcttaggaaagtagggaca
acctttggtattgttcttgataatcaagaagcgccaagatcaggtcatagaccatcagta
gatgtgatgtttgaagatgttagtcaatataaggattttgataaagtagcagtgattatg
accggtatggggcatgatggttcgaatggactgaaagcattaaaaaaaaccggtaatgtt
attgccattgctgagtcagcagaaacttgcattgtatatggtatgccaaaagcagcggta
gaaacgcaactagttgatgaagtagccgatgtagatgatatagcactaacaataatgaaa
tatttgccttaa

DBGET integrated database retrieval system