KEGG   Lysinibacillus sphaericus: Bsph_1590Help
Entry
Bsph_1590         CDS       T00656                                 

Definition
1-deoxy-D-xylulose 5-phosphate reductoisomerase
Orthology
K00099  
1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bsph_1590
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Bsph_1590
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1674237..1675382
Genome map
AA seq 381 aa AA seqDB search
MKKISLLGATGSIGWQTYDILKEQREAFQLVAFSSGKNMEKTREMIDNLKPELVSVQLEE
DALLLAKEYPTIHFTFGAQGLVEVATHPASTVLVNAVLGSVGLESTLAAIRMGKTIAIAN
KETLVTAGHLVMAEAKKYNATILPVDSEHSAIFQSMNGENPKDIERLIITASGGSFRDKT
RDQLKHVTVADALNHPNWSMGAKITIDSATMMNKGLEVIEAHVLFDMPYEKIDVLLHRES
IIHSLVEYHDTSVIAQLGTPDMRVPIQYALSYPDRIPLHNGQRLNLAQIGQLHFQEMDFE
RYPALRLAYEAGRTGGTILTAMNAANEAAVAAFLQGKITFLQIDETIERVMQAHQNIAIP
DLQTILQVDSETRKIVLDMVK
NT seq 1146 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaaaattagtttattaggtgcaactggttcaatcggttggcaaacctacgatatt
ttaaaagaacaacgtgaagcttttcaattagttgctttctcttcagggaaaaatatggag
aaaacacgagaaatgattgataacttaaagcccgaattagtttctgtgcagctagaagaa
gatgcgctactgcttgctaaggagtatccgactattcacttcacatttggcgcacaaggc
ttagtggaggttgctacacatccggcttcgacagttcttgttaatgctgtacttggaagt
gttgggctggaatccactttagcagccattcgaatgggaaaaacaattgcgattgcaaat
aaagaaacacttgtgacagctggacatttagtaatggctgaagcgaaaaaatacaacgca
actattttgccagttgatagtgagcattctgctatctttcaatcgatgaatggtgaaaac
cccaaagatattgaacgtttaattattactgcttcaggtggtagcttccgcgataaaaca
cgggaccaattaaaacatgtgactgtggctgacgcactgaatcacccgaattggtctatg
ggcgcaaagattacgatagattctgcaacaatgatgaataaaggtttagaagtaattgag
gcgcatgttttattcgatatgccatatgaaaaaatagatgtacttttgcatagagaaagt
attattcactctctagttgagtatcatgatactagtgtgattgcacaattaggcacacca
gatatgcgcgttcctatccaatatgctttaagttaccctgatcgtatcccgttacataat
ggtcagagactaaatttagcgcaaattggtcaattgcattttcaagaaatggactttgaa
cgttacccagcattgcgcttagcatacgaggctggccgtactggtggaaccatcctaaca
gcaatgaatgcagcaaatgaagcagcagttgcagcttttttacaagggaaaataacattc
cttcaaatcgatgagacgattgaacgtgtgatgcaagcacaccaaaacattgcaatacca
gatttacaaacgattttacaggtggacagtgaaacaagaaaaatagtgttagacatggta
aaataa

DBGET integrated database retrieval system