KEGG   Lysinibacillus sphaericus: Bsph_1810Help
Entry
Bsph_1810         CDS       T00656                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bsph_1810
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bsph_1810
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bsph_1810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1884073..1885272
Genome map
AA seq 399 aa AA seqDB search
MEGLKIINEEVVDMEIVNKERVVNLLRCLVQINTVNPPGNEKELASLLDVFVKDFGLETK
IIESLENRSTIVIYLRGKNKNAKKLYFSGHLDTVPIGEDEWDYDPFEARVENGLIYGRGT
CDMKGGVAALIEAMLILKESGTVLEHDIIFLGTAGEEVDCLGARTLMDNGVIENPGAIVI
AEPTSLEVFIGHKGVLWLEISTFGKTAHGSMPKQGINAISNMLKILEELNNLAFPLKDEL
LGSTTMSVNRIDGGVATNVIPDKCTVAVDIRTVTAETNELVIKSIEEVIRKLKSNDPSFV
ASISVLQNLRPLLNDSKDKFIQYAQKLNKDLNSKEIENIGVNYYTDASIFGKSLDCPIII
YGAGDEKLAHQPNENIEIESLIKSINYYVNLAKNFQDIY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggagggattgaaaattataaatgaagaagttgtagatatggagattgtaaataaggaa
agagtagtgaatttattaagatgtttagtacaaattaatactgtaaatcctcctggtaat
gagaaggaacttgcctcacttttagatgtatttgtaaaagattttggtttagaaacaaaa
attatagagtcattagaaaatcgatctactatagtcatttacttacgaggtaaaaataag
aatgcgaagaagctttacttcagcggtcatttagatactgtaccgattggggaagatgaa
tgggattatgatccattcgaagcaagggtagaaaatggcttaatttatggacgaggtact
tgcgatatgaaaggtggggtagcagcactcatagaggctatgctaattcttaaagaatct
ggaaccgtattagaacatgacatcatatttttaggaactgcaggtgaggaagtagattgt
ttaggtgcacggaccctaatggataatggagttatagaaaatcctggtgccatagttatt
gcggaacctactagtttggaagtatttattggacataagggtgtgctttggcttgaaatt
agtacctttggtaaaacagcacatggctcaatgcctaaacaaggaattaatgctatttcg
aatatgttaaagattttagaagaactaaataacttagcattccctttaaaagatgagcta
ttaggaagtactacaatgagtgttaataggattgacggtggggttgcaacaaatgttatt
cctgataaatgcacagtcgcagttgatattagaacagtaacggctgagacaaatgagtta
gtgataaaaagtattgaagaagtgattagaaaactaaagtcgaacgatccatcttttgta
gctagtattagtgttttacaaaatttaagacctctcttaaatgatagcaaagacaaattc
atacaatatgcacaaaaattgaataaggatttaaactcaaaagaaattgaaaatattggt
gtcaattactatacagacgcatctatcttcggaaaatcattggattgtccaataataatt
tatggtgctggggatgaaaaactagcccaccagccaaatgaaaatattgaaattgagagt
ttaattaaatcaatcaattactatgttaatctagcaaaaaatttccaggacatttattaa

DBGET integrated database retrieval system