KEGG   Lysinibacillus sphaericus: Bsph_1930Help
Entry
Bsph_1930         CDS       T00656                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bsph_1930
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     Bsph_1930
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2005384..2005953
Genome map
AA seq 189 aa AA seqDB search
MSNIDLLKIEEAVKMILEAVGEDVNREGLLDTPKRVAKMYAEMFSGLHEDAKDYFRTVFH
EDHEELVLVKDIPFYSMCEHHLVPFYGKAHVAYIPNDGIVAGLSKLGRAVETIARRPQLQ
ERITSSVADTIMEMLAPKGVYVVIEAEHMCMTMRGLKKPGSKTVTSVARGVYEEDEVKRR
EVLSFIQMS
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatatagatttattaaaaatagaagaagccgttaaaatgattttagaggcggta
ggtgaagacgtaaatcgagaaggtttattagatacaccaaaacgtgttgccaaaatgtat
gctgagatgtttagtggcttacatgaggatgctaaagactattttagaacagtgttccac
gaggatcatgaagagttggttcttgtcaaagatattcctttttattcgatgtgtgagcat
catctagttccgttttatggaaaagcacatgtcgcttacataccgaatgacggcattgtg
gcagggctaagcaaattaggtcgtgcagtagaaacaattgctcgtcgaccacagttgcaa
gagcgtattacgtcttcagtcgctgatacaataatggaaatgctagcaccaaaaggggtt
tatgtggtgattgaagctgagcacatgtgtatgaccatgcgcgggctgaaaaaaccaggc
tccaaaaccgtaacatctgtagcaagaggtgtttacgaggaagatgaagtgaaacgtaga
gaagttctatcatttattcaaatgtcttaa

DBGET integrated database retrieval system