KEGG   Lysinibacillus sphaericus: Bsph_2212Help
Entry
Bsph_2212         CDS       T00656                                 

Definition
(GenBank) Probable succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00300  Lysine biosynthesis
lsp01100  Metabolic pathways
lsp01120  Microbial metabolism in diverse environments
lsp01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bsph_2212
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Bsph_2212
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Transglut_core
Motif
Other DBs
NCBI-ProteinID: ACA39779
UniProt: B1HV68
Position
2274220..2275452
Genome map
AA seq 410 aa AA seqDB search
MTVTSLKTTKSYVRDRQAVIALTQKLVRIESVYRENDPKGNEEEVAHVVAAYLRDIGIET
HVEEVVPGRPNVIGIIDSGKPGKTLLFEGHTDVVTEGNRDAWAYDPFGAEIVEGRMYGRG
TNDTKGNLACMITACQSLLLDQEEFTGKIILCIPCDEEGLMLGIKHFIKNGWADGVDGAI
ICEPQENNVCIAQRGAIRLQVDIFGKMAHGAISWSGINPNWRMARLIVELEKLEKEEQAR
LGRDPMLNWPSITPTILRAPVKGDAQINVIPDHCMTTLDIRTVPAQDHDELLGRIESIIK
RLQADDPDFNVELTILDNRPATATAKEDAVVQAIYEAVAEVTEKEPKYNGVPGATDGTFL
HVHGIPIVTVGAGDREIPHQINEYVDIEELAETTAIYRLAALKFLAGDVQ
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atgacagtaactagtttaaaaacaaccaaatcgtatgtgcgagatcggcaggcggtcatc
gcgttaacacaaaagctagtacgaattgaaagcgtttaccgcgagaatgatccaaagggt
aatgaagaggaggtggcacacgtagttgcggcatatttaagggatattggcattgagacg
catgtagaggaggttgtgcctggccggccgaatgttattggtattattgattcgggcaag
cctgggaaaacattacttttcgagggtcatacagatgttgtaacggaaggaaatcgagat
gcatgggcatatgatccgtttggagcagagattgttgaggggcgtatgtacggcagagga
acaaatgatacgaaggggaatctcgcatgtatgattactgcctgtcaatcactactacta
gatcaggaagagtttacaggcaagattattttatgtattccttgtgatgaagaggggctc
atgctgggcattaaacattttattaaaaacggctgggcagacggagtagatggggctatt
atttgtgagccacaggaaaacaatgtatgcattgcacagcgtggggcgattcgtttacag
gttgatattttcggtaagatggcacatggagcaatctcgtggagtggcattaatccgaac
tggcgtatggcacgattgattgtagagctggagaaactagaaaaagaggagcaggctcgg
ttaggacgtgacccaatgctgaattggccatctataacaccaacgattttacgtgcgcct
gttaaaggagatgcacaaatcaatgtcattcctgatcactgcatgacgacacttgatatt
cgtacggttcctgcccaagaccatgatgaactactaggaagaatcgaatccattattaaa
cgattacaggcagatgatccggattttaacgtggaactaacgattcttgataatcgacct
gctacagcaactgctaaggaagatgctgttgtacaggccatttacgaggcagtagcagag
gtgacagagaaggagccaaaatataatggtgttcctggtgctacagatggtacgtttctt
catgtccatgggattccaatagtgacggttggtgcaggagatcgtgaaattcctcatcaa
atcaatgaatatgtagatattgaagaattggcagaaacaactgccatttatcgtttagcg
gcattaaaatttttggctggtgatgtccaatga

DBGET integrated database retrieval system