KEGG   Lysinibacillus sphaericus: Bsph_2230Help
Entry
Bsph_2230         CDS       T00656                                 

Definition
(GenBank) Glutamate 5-kinase 1
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
lsp  Lysinibacillus sphaericus
Pathway
lsp00330  Arginine and proline metabolism
lsp00332  Carbapenem biosynthesis
lsp01100  Metabolic pathways
lsp01130  Biosynthesis of antibiotics
lsp01230  Biosynthesis of amino acids
Module
lsp_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bsph_2230
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Bsph_2230
Enzymes [BR:lsp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Bsph_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ACA39797
UniProt: B1HVU9
Position
complement(2293202..2294317)
Genome map
AA seq 371 aa AA seqDB search
MTIGGSVVEKKRIVVKIGSSSLTNAKGEIDKVRLMDHVQAIAELKKQGHDVLLVSSGAVA
AGFKQLGYPARPVTVKGKQAAAAVGQSLLIQSYSALFSIYDILPAQILLTRTDFSKKECY
KNAYATFEELLERSMLPIINENDTVSISELTFGDNDMLSALVSGLVHADQLIILTDINGL
YNANPSKNPQAERIDYLTSITDDLLDFADSTGSKVGTGGMASKLLAARTALQAGVKVFIG
TGYGAQKLVDILAGRGDGTYVGHDDLAVLKNHKQWIALAEISGKIFIDRGAEQALMVNGK
SLLPAGVFQVEGDFNNGDVVEVYCEQGLLGRGEVLYSSQELLSAMGKRTNTLSKCPIEVI
HRDKWLKIQTK
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
ttgacaattggaggtagtgtggtggaaaaaaagagaattgtcgtcaagattgggagtagc
tctttaacaaatgcaaaaggcgaaatcgataaagttcgtttaatggatcatgttcaggca
atcgcggagttgaaaaaacaaggacatgatgtattacttgtgtcatcaggtgcagtagca
gcaggttttaaacagcttggctacccggctcgtcctgttacggtaaagggcaaacaggca
gcagcagctgtagggcaaagcttacttattcaatcgtatagtgcattatttagtatttat
gatatattgcctgctcagattttactgacgcgcactgatttttctaaaaaagaatgctat
aaaaatgcctatgctactttcgaggaattgcttgagcgctcgatgctacctatcattaat
gaaaatgataccgtttctataagtgagctaacctttggcgacaatgatatgctgtctgcc
cttgttagtggacttgttcatgcagatcaactcatcatattaacagatattaatggctta
tataacgccaaccctagcaaaaaccctcaggcagagcgaattgattatttaacgtccatc
acggacgacttgttagactttgcagacagcacagggtcaaaggttggaacaggcggcatg
gcatcgaagctactggctgcccgtacagctttacaggctggagttaaagtttttatcgga
acaggttatggcgctcaaaagcttgttgatattttagcagggcgtggtgatggaacttat
gtcggacatgatgacctagccgtgttaaagaatcataaacagtggattgcactcgcggaa
atatctggtaaaatttttatagatagaggtgctgaacaagcactaatggtcaatggcaaa
agcttgttacctgctggtgtttttcaggttgaaggtgattttaacaatggtgatgtagtt
gaagtgtattgtgaacaaggtttactaggacgtggtgaggtgctgtattcatcacaagaa
cttttgtccgctatgggcaaacggacaaatacattatcgaaatgcccgattgaggtcatt
cacagggataaatggctgaaaattcaaactaaataa

DBGET integrated database retrieval system