KEGG   Lysinibacillus sphaericus: Bsph_2432Help
Entry
Bsph_2432         CDS       T00656                                 

Gene name
ybbD
Definition
lipoprotein ybbD
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
lsp  Lysinibacillus sphaericus
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:lsp00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:lsp00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2460035..2461735
Genome map
AA seq 566 aa AA seqDB search
MHKRRRGLLLFLVLILMGLLFFIGMKMRPATQTTRNSESPPVQEHSDHATEGGDTGNLDV
VIQDIVNLAGEGKVPDVPFVAGESDSRTVHQQWGDPQQVTESANGQYEDFLQQEITIGFQ
STKAFDIRSFKADIRNIHLADIKNKLGEPDEVRYYQDTKTNQIILVYQVNDHYQLKWILP
KPTDGDANPAVHHISVYTAITDDIAETINQMTLDEKLGQMMFAGVSGTSLQQETTSLIRD
YKVGGLILYANNLETPQQTVSLMNDLMAANGTNRLPLFLGTDQEGGKVVRLPGPLKNFPT
NQKIGQINQAQFSYEIGQLLGEQLKAFGFNLDFAPVMDVNSNPNNPIIGDRSFSNKPDIV
SQLGIQTMQGLESQQVIPVIKHFPGHGDTSVDSHLELPKVSKSLDDLTKLELIPFKAAID
KGVDVVMVGHILLPKIDQQYPSSMSKEIITGILRNQLGFDGVVMTDDMTMKAITNHFNIG
QAAVDSVKAGNDIILIAHEFANVTAAIDALKAAVKNGEITEQQINDSVRRIIQLKEKYQL
VNQPVSAVDLNKLNAHMVQVLNTYLK
NT seq 1701 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaagaagacgtggcttgctcctatttcttgtgctgattttaatgggtttgctc
ttttttatcggtatgaagatgcgaccagccacacaaacgactagaaattcggagtcaccc
ccagtccaggagcatagcgatcatgcaactgagggcggcgataccggaaatcttgacgta
gtcattcaggatattgtcaacctagcaggagaaggaaaagtacctgatgtgccatttgtc
gcaggggagtcagatagccgtacggttcatcagcaatggggggaccctcagcaagtaacg
gagtccgctaatggacaatacgaggattttcttcaacaagagataacgattggctttcaa
agtacaaaagctttcgatatccgttcatttaaagcagatataaggaatattcatttagca
gatattaaaaataaattgggcgagcctgatgaggtccgctattatcaggacacaaagacc
aatcaaattattttagtgtatcaggttaacgaccactatcaactaaagtggattttgcca
aagccgactgacggtgatgccaatcctgctgttcatcacatctctgtctatacagcaata
acggatgatatagcagagacaatcaaccagatgacattggatgaaaagctgggtcaaatg
atgtttgccggtgtttcgggcacatcacttcagcaagagacaacgagtttaattcgtgat
tacaaggttggaggattgattctttatgccaataatcttgaaacgccacagcaaacagtc
tcactgatgaatgatctaatggcagcgaacgggactaatcgactaccattatttttggga
actgaccaagaagggggcaaagtagtcagattaccagggccgttaaaaaatttcccaacg
aaccaaaagattgggcaaatcaatcaagcacaattctcctatgagattggtcaattatta
ggggaacaattaaaggcatttggcttcaatctagacttcgcccctgtaatggatgtgaac
agcaatccgaacaacccgattattggtgatcgttcgttctctaataagcctgatatcgtt
agtcaattaggaattcagactatgcaggggttagaaagtcagcaggtaattccagtcatt
aagcatttccctggtcatggtgatacatcagtagattctcacttagagctacccaaagtg
tcgaaaagtctagacgatttaactaagctagagcttattccatttaaagcggcgattgat
aaaggcgttgatgtggttatggtcggtcatattttattacctaaaatcgatcaacaatac
ccttcatcgatgtcaaaggaaattattactgggattttaagaaatcagcttggctttgat
ggggttgtaatgacggacgatatgacgatgaaggccattacgaatcattttaatattggg
caagctgctgtagattctgtgaaggcgggtaatgatattattttaattgcccatgaattc
gccaatgtcacagcggccatagatgcattgaaggcagccgtaaagaacggggaaatcaca
gagcagcaaattaatgacagtgtccgtagaatcattcagctgaaagaaaaatatcagctt
gtgaatcagccagtatcagcagttgatcttaataagctcaatgcacatatggtccaagta
ttaaatacgtatttgaaataa

DBGET integrated database retrieval system