KEGG   Lysinibacillus sphaericus: Bsph_2467Help
Entry
Bsph_2467         CDS       T00656                                 

Definition
carboxylesterase
Orthology
K03928  
carboxylesterase [EC:3.1.1.1]
Organism
lsp  Lysinibacillus sphaericus
Brite
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     Bsph_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2489767..2490591
Genome map
AA seq 274 aa AA seqDB search
MAYVIPLCYKYNKKVALKRLPSIMMNVKKGSDVVLTILPAKEIYLKGNEHAVLLLHSFTS
HTRDMKKVATKLHEKGYTCYVPLYRGHGQKPELLVQYEVEDWWQDVLKAHQFLLDEGYQT
ISVIGLSIGGVFTLKLAQLKKLQQIIVLSVPINKEPAQLKQRIIDYAYNYKHIEGKSASQ
VTDEMKPFSDMPLDAMIAFQHFIIETMQQLEKITIPIAIFYGKRDEDLYAYSADTIYQRV
HSARKHKRGFENSKHLMTLGREQDKILQEIMSFL
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
gtggcatatgtcattccattatgctataaatacaacaagaaggtagccttaaagaggcta
ccttctattatgatgaacgtgaagaaaggttctgatgttgtgcttactattttaccggct
aaagaaatatacttgaaaggaaatgaacacgcggtattacttttacattccttcacaagc
catacaagagatatgaagaaagtggcgacgaagctacacgaaaagggctatacatgttat
gtacctctatacagaggacacggccagaagccagaactgttagtacagtacgaagttgag
gactggtggcaggatgtgttgaaagcgcaccaatttttgctggatgaaggctatcaaaca
atttccgttatcggcttatccatcggtggtgtatttacattgaaacttgcacaattaaaa
aagctacagcaaatcattgtcttatcggtaccgattaataaggagccagcacaactaaaa
caaagaatcattgactatgcttataattataaacatatcgagggtaaatcagcgtctcaa
gttacagatgagatgaagccgtttagtgatatgccattggacgcgatgattgcatttcag
cattttattatagaaacgatgcagcagcttgagaaaatcacgattccaattgctattttc
tacggcaaaagagacgaggacttatacgcgtatagtgctgacacaatctatcagcgtgtt
cattctgctaggaaacacaaaaggggctttgaaaactccaagcatttaatgactttaggt
cgtgagcaggataaaatccttcaggaaatcatgagttttttatag

DBGET integrated database retrieval system