KEGG   Lysinibacillus sphaericus: Bsph_2554Help
Entry
Bsph_2554         CDS       T00656                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:lsp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lsp00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lsp00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lsp00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2553982..2554575
Genome map
AA seq 197 aa AA seqDB search
MSVVAFDNRKTTFIYMVRHGESPYVGNERTRGLTVKGHLGAQSIADVLKSEGIDIILSSP
YTRSILTVEPLAKQLSQEVIVCEELKERIFSSEEKRLPDSQLFPLLEKSFLDPNFAIEGG
ESNTDCQTRAVRALKELLITYEGQKVVIGTHALVMTLMMGYFHETYNLDFLLQTTKPDIY
KMEFRGQQLVGVKRLGM
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtggtggcatttgataatagaaaaacgacgttcatttatatggtacggcacggt
gaatctccgtatgttggaaatgaacggacaagagggttaactgtgaaaggacatttaggt
gctcaaagtatagctgatgtgttaaagagtgaaggaatcgatattatcctatccagtcca
tatactcgttcaatattaactgttgagccattagctaaacaattgagtcaggaagtgatc
gtttgtgaagaattaaaagagagaattttttcttcagaagaaaagcgattacctgatagt
caattatttcctctattggagaaatccttcttggaccccaattttgcaatagagggtgga
gaatcgaataccgattgtcaaacaagagctgtaagagctttaaaagagctattaattact
tatgagggacaaaaagtagtaataggaactcatgcattagtcatgaccttaatgatggga
tactttcatgaaacgtacaatttagattttttgctacaaacaaccaagccggatatatac
aaaatggaatttaggggacagcaattggtgggtgttaagaggctaggcatgtag

DBGET integrated database retrieval system