KEGG   Lysinibacillus sphaericus: Bsph_2621Help
Entry
Bsph_2621         CDS       T00656                                 

Definition
phosphoglycerate/bisphosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Class
Metabolism; Overview; Carbon metabolism [PATH:lsp01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:lsp01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:lsp00010]
Metabolism; Energy metabolism; Methane metabolism [PATH:lsp00680]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:lsp00260]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2602710..2602871
Genome map
AA seq 53 aa AA seqDB search
MIGDTYESIAIVAHGGVINNILRAFYQMPINMDYYFKIGDTGISLIELTKRKR
NT seq 162 nt NT seq  +upstreamnt  +downstreamnt
gtgataggagatacatatgaaagtatagcgattgttgctcatggtggagtaattaataat
atattacgtgctttttaccaaatgccaatcaatatggattattattttaaaattggagat
acgggaattagcctaattgaacttacgaaaaggaaaaggtaa

DBGET integrated database retrieval system