KEGG   Lysinibacillus sphaericus: Bsph_2724Help
Entry
Bsph_2724         CDS       T00656                                 

Definition
dihydrofolate reductase type 3
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
lsp  Lysinibacillus sphaericus
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bsph_2724
   00670 One carbon pool by folate
    Bsph_2724
Enzymes [BR:lsp01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bsph_2724
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2694951..2695427
Genome map
AA seq 158 aa AA seqDB search
MISLIVAHDDNHVIGYNNGMPWHLPGDLQYFKNKTMGKPMIMGRKTFESIGRPLPGRRNI
VITRDENYRAEGIEIVTSLEEAITMAGDVQEIMIIGGEQIFRLSMEIADRLYITKINHSF
QGDTFFPSYEQDFVEVAAEQPETASEGYTFQYQIFERK
NT seq 477 nt NT seq  +upstreamnt  +downstreamnt
atgatttctttaattgtggcacatgatgacaaccatgtaattgggtataataacggaatg
ccttggcatttacctggagatttgcagtattttaaaaacaaaacaatgggcaagccaatg
attatgggccgaaaaacgtttgaatccattggtcgtccactaccaggacgtcgtaatatt
gttattacacgagatgaaaattatcgtgcagaaggcattgaaattgtgacaagcctagaa
gaagcaataacaatggcaggggatgtacaggaaattatgattattggcggcgagcaaatt
ttccgtttatcgatggaaatagcagatcgcttatatattacgaaaatcaatcattctttt
cagggcgatacctttttcccaagctatgagcaggattttgtagaggttgctgctgaacag
cctgaaacagcttcagaaggctatacattccaatatcaaatttttgaacgtaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system