KEGG   Lysinibacillus sphaericus: Bsph_2786Help
Entry
Bsph_2786         CDS       T00656                                 

Definition
dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bsph_2786
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bsph_2786
  Amino acid metabolism
   00310 Lysine degradation
    Bsph_2786
Enzymes [BR:lsp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Bsph_2786
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2750323..2751585
Genome map
AA seq 420 aa AA seqDB search
MKVAEIKVPELAESITEGSIAQWVKKVGDRVEKGEFIVELETDKVNAEIISEEAGVLTQI
LAEEGDTVLVGQVIAIVEAGEGAAAAPVAAAPAEAAPAPAAPQAAPAAPVAAAPVVEETS
GERVIASPAARRLAREKGIDLAAVSPVDPQGRVRVQDVAAHGTAPVVAAPTPVATTGGPV
VFTPAANSDRVTIEKMSRRRQTIAKRLLEVKQSTAMLTTFNEIDMTNIMALRKRKQEEFV
KANDIKLGFMSFFTKAVVAALKKYPYVNAQISGDEIHLNNFFDIGIAVSTEEGLVVPVVR
DANSKNFAEIEKDIANLATKARDKKLGLNDMAGGSFTITNGGVFGSLMSTPIMNGTQAGI
LGMHSIVNRPVAVNGEVQIRPMMYVALSYDHRIIDGKDSVGFLKTVKELIENPEDLLLNS
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtggctgaaattaaagtccctgaattagcagaatcgattacagaaggtagtatc
gcacagtgggtaaaaaaagtgggcgatcgcgttgaaaaaggtgaattcatcgttgaactt
gaaacagataaagtaaacgctgaaatcatttctgaagaagcaggtgtattaacacaaatt
ttagctgaagaaggcgatactgtactagttggtcaagttatcgcaattgtagaagcaggc
gaaggcgcagcagctgcaccagtagcggcagcaccagctgaagcagctccagctccagca
gcgccacaagcggcacctgcagcaccagtagcagcagctcctgtagtagaagaaacttct
ggtgagcgtgtcatcgcatctccagctgcacgtcgacttgcacgtgaaaaaggtattgac
cttgcagcggtatcaccagtagatccacaaggccgtgtacgtgtacaagatgtagcggca
catggtacagcaccagtagtagcagcacctacaccagtagcaactacaggtggcccagtt
gtattcacaccagcagctaattctgaccgtgtaacgattgaaaaaatgagccgtcgtcgt
caaacaattgcaaaacgtttattagaagttaaacaatcaacagcaatgttaacaacattc
aacgaaattgacatgacaaacatcatggcacttcgtaaacgtaaacaagaagagtttgtg
aaagcaaacgacatcaaacttggtttcatgtcattcttcactaaagctgttgttgcagca
ctgaaaaaatacccatacgtaaacgctcaaatctctggcgatgaaattcatttaaataac
ttctttgatatcggtattgcagtatcaactgaagaaggtttagtagtaccagttgtacgc
gatgcgaatagcaaaaactttgcagaaatcgaaaaagatatcgctaacttagcgacaaaa
gctcgtgataaaaaattaggcttaaatgacatggctggtggatcattcacaatcacaaat
ggtggtgtattcggttcattaatgtcaacaccaattatgaacggtacgcaagctggtatt
ttaggtatgcactccattgtaaaccgtccggttgcagtaaatggtgaagttcaaatccgt
ccaatgatgtatgtagcactttcttacgatcaccgtatcatcgatggaaaagattctgta
ggattcttaaaaacagttaaagagttaatcgaaaatcctgaagatttattattaaattca
taa

DBGET integrated database retrieval system