KEGG   Lysinibacillus sphaericus: Bsph_3876Help
Entry
Bsph_3876         CDS       T00656                                 

Definition
exodeoxyribonuclease V-like protein
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bsph_3876
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Bsph_3876
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3751705..3754050)
Genome map
AA seq 781 aa AA seqDB search
MYSIIRVKIQETNLQYEDKEIIVVGYFPPLQMDEQYRFTGILKQHPKYGAQFQIETFTKE
VPATEQGIIHYLSSDLFVGIGRKTAETIVEKLGANALRLILEDPSALDVVPRLSSEKKEV
IHRTIEQNLGLERVMIQLNEWGFGPQLGMKIYQTYRTEAVELLTENPYRLIEDVEGVGFF
RADELGAKLGITGKHPDRVKAAILHILNTAALSDGHVYLDAEHVLPLVKEMLEQSQRQEI
PFEDISKACIELREDGKVCGEETRLYLPSLYFSEVGIASKILTLVERNSKTEHFSKDEIR
KAIGETEELLQVTYAETQANAIEQALNSAVMILTGGPGTGKTTVVRGVVEVYAKLHGLSL
NPKEYAQKEEPFPIILCAPTGRAAKRLAESTELPAMTIHRLLGFTGQEKEEETEREVTGK
LIIVDEMSMVDTWLAHQLLKALHEDVQVVFVGDQDQLPPVGPGQVLKDLLASKQLPTVEL
TDVYRQAEGSTIIELAHQIKKGTIPQDLTSKTTDRSFIKSSVDQVGNVVTQVVKSAVAKG
QEIRNIQVLAPMYKGPAGIDNLNKMIQELINPNDTGTRKELVFGDVTYRIKDKVLQLVNQ
PESNVFNGDMGEVISIIKAKETVEKQDLLIVSFDGIEVTYQRSDLNQLTLAYCCSIHKSQ
GSEFQTVIMPVVKGYSKMLRRNLLYTGITRAKNFLILCGEPDVLADGLQRTDDLQRFTSL
RARLNPMDVDEVMVEVEAVPVKQEAVQEIAIEDHKLTVETAPYIHPMIGMDDVSPYDFLE
M
NT seq 2346 nt NT seq  +upstreamnt  +downstreamnt
atgtattccattattcgagtgaaaattcaagagacaaacttacaatatgaagataaagaa
attattgttgttggctattttccaccgttacaaatggatgagcaataccgctttacaggt
atattaaaacagcatcctaaatatggtgcacaatttcaaatcgagacatttacaaaagag
gtacccgctactgaacaaggaattattcattatttatccagtgacctatttgtgggaatt
gggagaaaaacagctgaaaccattgttgaaaaactgggtgctaatgcattacgccttatt
ttagaagatccgagtgcactggatgttgttccacgtttatcatctgaaaaaaaagaagtg
attcatcggacgattgagcaaaaccttggtttagaacgggtaatgatacagttgaatgaa
tggggctttggtccacagctgggaatgaagatctatcaaacctatcgaacggaggctgtt
gaattactaacagaaaatccatatcgcttgatagaagatgtggaaggtgttgggttcttt
cgagcagatgagcttggtgcaaagctagggattaccggtaaacatcctgatcgtgtcaaa
gcagcgattttacatattttaaatacggctgcattatctgacgggcatgtatatttagac
gcggagcatgtactaccacttgtaaaggaaatgcttgaacaaagtcaacgtcaggaaatt
ccgtttgaagacatctcaaaagcatgtattgagctacgggaagatggaaaagtttgcgga
gaagaaacaaggttatatttgccttcactttatttttctgaggtaggaattgcctccaaa
atattgacgcttgttgaacgaaatagcaagactgaacattttagcaaagatgagattcgt
aaagcgattggtgaaactgaggaactactccaggtgacatatgctgaaacacaagcaaat
gctattgaacaggctttaaattcagctgtaatgattttaacaggtggacctggtacgggt
aaaacgactgttgtacgtggggttgttgaagtgtatgcgaagcttcatggtttatcattg
aatccaaaagaatatgctcaaaaagaggagccttttcccattatcctttgtgcacccact
gggcgagctgccaagcgcttagctgaatcgactgaactaccagctatgaccattcatcgt
ttactcggctttacaggtcaagaaaaagaagaagagactgaacgggaggtaacaggtaag
cttattattgtagatgaaatgtccatggtggatacttggcttgctcatcagttattaaaa
gctttacatgaggatgtacaggttgtctttgtaggggaccaggaccaattaccgcctgta
ggaccaggacaggtattaaaggatttattagcatccaagcaactcccaacggtggaattg
acagatgtttaccgacaagcagagggttctaccattattgaattagcccatcaaataaaa
aaaggaaccatcccgcaagatttaacatcgaaaactactgatcgctcgtttattaaatct
tccgtcgatcaggttggaaatgttgtgacacaggtagtaaaaagtgccgttgctaaaggg
caagaaattcgtaatattcaggtgttagcaccgatgtataaaggtcccgctggcattgat
aatttaaataagatgattcaagagcttattaatcctaatgatacagggacacgaaaggaa
cttgtctttggggacgtaacgtatcggataaaggataaagttctgcagctagtcaatcag
cctgaaagtaatgtttttaatggggatatgggagaggtcattagtattattaaggcaaag
gagacagtagaaaaacaagatttactaattgtatcctttgatggcattgaagtgacctat
caacgcagtgacctcaatcaattgacacttgcttattgctgctccattcataaatctcaa
ggttcagagtttcaaaccgtcattatgcctgttgtcaaagggtattcgaaaatgctgcgg
cggaatcttttatacacaggtattacaagagcgaaaaactttttaattttatgtggggaa
ccagacgttctagcagatggcttgcagcggacagatgatttacagcgttttacttcgttg
cgtgctcgattaaatccaatggatgtcgacgaagtaatggttgaggttgaggcagttcca
gtaaaacaagaggctgtgcaagaaatagctatcgaggaccataaattaacagttgaaaca
gctccttatattcatccaatgattgggatggatgatgtctccccctatgattttttggag
atgtaa

DBGET integrated database retrieval system