KEGG   Lysinibacillus sphaericus: Bsph_3917Help
Entry
Bsph_3917         CDS       T00656                                 

Definition
(GenBank) Tryptophan synthase beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bsph_3917
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bsph_3917
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bsph_3917
Enzymes [BR:lsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bsph_3917
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(3794180..3795307)
Genome map
AA seq 375 aa AA seqDB search
MTALLELENAYEEALEDSSFTEELSYYLQDYVGRETPLYFAENLTKKLGGAKIYLKREDL
NHTGAHKINNAIGQALLAKRMGKKKIVAETGAGQHGVATATACALLNLECVVFMGAEDIK
RQQLNVFRMELLGTKVQSVESGSKTLKDAVNAALRYWVTNVEDTHYILGSALGPHPFPKI
VRDFQRIIGVETRTQILQKEGRLPDAVVACIGGGSNAIGMFHPFVDDESVALYGVEAAGS
GLETGRHAAAIAGGQLGVLHGAYMYLLQDANGFVQEAHSISAGLDYPGKGPEHCYLHDIG
RAQFNAITDAEALEGLQLLSRTEGILPALESSHAIAYTAKLAKTMQSDSIIVVCLSGRGD
KDVHTVRAALGGDMK
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgactgccttgctagaattagagaatgcctacgaggaagctttagaagattcctcgttt
actgaagagctatcctactatttgcaggactatgtgggacgtgaaaccccgctttatttc
gcagaaaatcttacaaagaagcttggtggagctaaaatctatctaaagcgtgaagactta
aatcatacaggtgctcataaaattaataacgcgattggccaggcacttcttgccaaacga
atgggaaaaaagaagattgttgcagagacaggagctgggcaacatggtgtagcaacggct
accgcatgtgccttattaaatcttgaatgtgttgtttttatgggtgcagaagatattaaa
cggcagcagttaaatgttttccgtatggaactacttggcacgaaggttcagtcggtagaa
agtgggtcaaaaactttaaaggacgctgtaaatgctgctttgcgctattgggtgacgaat
gtggaggatacgcattatattttaggctctgccttaggcccacatccatttccaaaaatt
gttcgtgattttcagcggattatcggggttgagacaagaacgcaaattttgcaaaaggaa
ggtcgcttaccagatgcagttgtcgcttgtattggtggtggcagtaatgcaattggtatg
tttcatccattcgttgacgacgaatcggttgccttatatggtgtagaggcagcagggagt
ggtcttgaaactgggcggcatgcagcggctattgcaggtggacaattaggggtattacat
ggcgcttacatgtatttactacaagatgcaaatggctttgttcaagaagcgcactctatt
tcagcggggttagactatccgggaaaagggccagaacattgttatttacacgatattggt
cgagctcaatttaacgccattacagatgctgaagcgttagaaggattacaattattaagt
agaacagagggcatacttcccgcgcttgaaagctcccatgcaattgcttatactgcaaag
cttgccaaaacaatgcagagtgacagcattattgtggtgtgcttatctggccgaggggat
aaagatgtacacacagttcgtgcagcactaggaggggatatgaaatga

DBGET integrated database retrieval system