KEGG   Lysinibacillus sphaericus: Bsph_3938Help
Entry
Bsph_3938         CDS       T00656                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Bsph_3938
Enzymes [BR:lsp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bsph_3938
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3811749..3812369)
Genome map
AA seq 206 aa AA seqDB search
MYDYLKGLITRITPEYIVLEQKGIGWQLNTPNPFAFRTSAMEQQIYVHLHVREDAQVLYG
FPNLDQRELFRKLILVSGIGPKGALAILATGNPQQVISAIEREDETFLVKFPGVGKKTAR
QMILDLKGKLGSLLETIELPSTEDELPLFGVHPYKHELEEAILALAALGYSEKELEKIRP
LLEDNDKLETTDAYMKQALQLLLKLK
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgtatgattatttaaaaggactaattactcgtattacaccagaatatattgtgctagaa
caaaagggtattggctggcaattgaatacgcccaatccgtttgcatttcgaacatcagcc
atggagcaacaaatttatgttcatttgcatgtacgagaggatgcacaagtgctttatggt
ttcccaaatctagatcaacgcgagctttttcgaaagttaattttagtatctggaataggt
cctaagggagcgctggctatcttagcgactggcaacccacagcaggttataagtgcgatt
gaacgggaagatgaaacgtttttagtgaagttcccaggagtaggtaaaaaaactgctcgt
cagatgatattagatttaaaaggcaagctaggctctttattagagacaatcgaactgccg
agtacagaagatgagctgccattgtttggcgttcatccttataaacacgaattagaagaa
gcaatacttgctttagcggcacttggttactctgaaaaggagctcgaaaaaattcgccca
ctgcttgaggataacgacaagctggaaacgacagatgcctatatgaaacaagcgttacaa
ctattattaaaattaaaataa

DBGET integrated database retrieval system