KEGG   Lysinibacillus sphaericus: Bsph_3969Help
Entry
Bsph_3969         CDS       T00656                                 

Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
lsp  Lysinibacillus sphaericus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:lsp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bsph_3969
Enzymes [BR:lsp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bsph_3969
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3838727..3839488)
Genome map
AA seq 253 aa AA seqDB search
MQNDLPLRGKTVLLTGTSKTTAIVDDIAALGGHAVIAPLIETCERMDNNDAKLMNSALQF
DWVIFTSQNAVDAFANKMGRHQISAKNFRAKIASIGTKTTTALENLGFQVSFMPSVFSAD
IFVKEFPNIAGDHPSCLFIRGEKAKSTLKDGLPFNLKEWTVYETIERQDQTLAIINCIQH
NEDVTVIFASPSAVDVYAKSVAVHVGWQATRVAAIGHITEAALEQYGATVDIMPSVYTMQ
AVIEELMKVGDKS
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatgatttacctttaagaggtaaaacggtacttttaacaggtacatctaaaaca
acagctattgtagatgatattgcagctttaggtggccatgcagttattgccccattaatt
gaaacatgcgaacgtatggacaacaatgatgcaaaactaatgaatagtgcgcttcaattt
gactgggttatctttacgagtcaaaatgctgttgatgcctttgctaataaaatgggacgg
catcaaataagtgccaaaaattttcgcgcaaaaattgcttccattggcactaaaacaact
acagcgttagaaaatctaggatttcaagtgagctttatgccttccgtatttagtgctgat
attttcgtcaaggaatttccaaatatagctggtgaccatccaagttgtctgtttattcgt
ggagaaaaggcgaaaagtacgttgaaggatggactgccctttaatttaaaagaatggaca
gtttatgaaacgatagaacgacaagatcaaacgttagctattattaattgcattcagcac
aatgaggacgtcacagtgatttttgctagtccttcagctgtagatgtatatgcaaaaagt
gtagcggtacatgttggatggcaggctacaagggttgcagccatcggtcatattacggaa
gcagctcttgaacaatacggtgcaactgtggatattatgccgagtgtatatacaatgcaa
gcagtcatcgaagaattaatgaaagtaggggacaaatcatga

DBGET integrated database retrieval system